(data stored in SCRATCH zone)

EMBL: AL009126.RICT

AL009126.RICT        Location/Qualifiers
FT   CDS             41657..42484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ricT"
FT                   /locus_tag="BSU_00320"
FT                   /old_locus_tag="BSU00320"
FT                   /product="subunit of a sporulation, competence and biofilm
FT                   formation regulatory complex of RNaseY (RicAFT complex /
FT                   FAD / two [4Fe-4S]2+)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12270811, 23490197, 26434553,
FT                   27501195, 28295778; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11808"
FT                   /db_xref="GOA:P37541"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="SubtiList:BG10096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37541"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12270811, 23490197, 26434553, 27501195, 28295778"
FT                   /protein_id="CAB11808.1"
FT                   /translation="MYNVIGVRFKKAGKIYYFDPNGFHIEHDSCVIVETVRGVEYGQVV
FT                   IANKQVDEHDVVLPLRKVIRVADDRDLLIVEENKQEALSAFDICQKKVIEHGLDMKLVD
FT                   VEFTFDRNKVIFYFTADGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDI
FT                   GEMITTANGPAKVVGLNILERVLQVELINREKVIEYTWEELLEEGVVSAQTTD"
     MYNVIGVRFK KAGKIYYFDP NGFHIEHDSC VIVETVRGVE YGQVVIANKQ VDEHDVVLPL        60
     RKVIRVADDR DLLIVEENKQ EALSAFDICQ KKVIEHGLDM KLVDVEFTFD RNKVIFYFTA       120
     DGRVDFRELV KDLASIFKTR IELRQIGVRD EAKMLGGIGP CGRMLCCSTF LGDFEPVSIK       180
     MAKDQNLSLN PTKISGLCGR LMCCLKYEND EYETAKEQLP DIGEMITTAN GPAKVVGLNI       240
     LERVLQVELI NREKVIEYTW EELLEEGVVS AQTTD                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page