(data stored in SCRATCH zone)

EMBL: AL009126.RIDA

AL009126.RIDA        Location/Qualifiers
FT   CDS             55295..55672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ridA"
FT                   /locus_tag="BSU_00480"
FT                   /old_locus_tag="BSU00480"
FT                   /product="aminoacrylate/iminopropionate
FT                   hydrolase/deaminase"
FT                   /function="16.3: Control"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.99.10"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2113912, 12515541, 14729707,
FT                   10557275, 10919400, 10368157, 20562306, 23815688; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11824"
FT                   /db_xref="GOA:P37552"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="PDB:1QD9"
FT                   /db_xref="SubtiList:BG10111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37552"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11824.1"
FT                   /translation="MTKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGD
FT                   IKEQTHQVFSNLKAVLEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSC
FT                   VEVARLPKDALVEIEVIALVK"
     MTKAVHTKHA PAAIGPYSQG IIVNNMFYSS GQIPLTPSGE MVNGDIKEQT HQVFSNLKAV        60
     LEEAGASFET VVKATVFIAD MEQFAEVNEV YGQYFDTHKP ARSCVEVARL PKDALVEIEV       120
     IALVK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page