(data stored in ACNUC7421 zone)

EMBL: AL009126.RLMB

AL009126.RLMB        Location/Qualifiers
FT   CDS             115269..116018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="BSU_00960"
FT                   /old_locus_tag="BSU00960"
FT                   /product="23S rRNA (Gm2251)-methyltransferase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.1.185"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11698387, 12377117, 16014871;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00960"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11872"
FT                   /db_xref="GOA:Q06753"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="SubtiList:BG10157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06753"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11872.1"
FT                   /translation="MSQQHDYVIGKNAVIETLKSDRKLYKLWMAENTVKGQAQQVIELA
FT                   KKQGITIQYVPRKKLDQMVTGQHQGVVAQVAAYEYAELDDLYKAAEEKNEQPFFLILDE
FT                   LEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTL
FT                   EEMKERGIWVVGTDASAREDFRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAG
FT                   KVTSLNASVAAGLLMYEVYRKRNPVGE"
     MSQQHDYVIG KNAVIETLKS DRKLYKLWMA ENTVKGQAQQ VIELAKKQGI TIQYVPRKKL        60
     DQMVTGQHQG VVAQVAAYEY AELDDLYKAA EEKNEQPFFL ILDELEDPHN LGSIMRTADA       120
     VGAHGIVIPK RRAVGLTTTV AKASTGAIEH IPVARVTNLA RTLEEMKERG IWVVGTDASA       180
     REDFRNMDGN MPLALVIGSE GKGMGRLVKE KCDFLIKLPM AGKVTSLNAS VAAGLLMYEV       240
     YRKRNPVGE                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page