(data stored in SCRATCH zone)

EMBL: AL009126.RLMG

AL009126.RLMG        Location/Qualifiers
FT   CDS             121068..121673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmG"
FT                   /locus_tag="BSU_01060"
FT                   /old_locus_tag="BSU01060"
FT                   /product="23S rRNA m2G1835 methyltransferase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.1.1.174"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 17010380; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11882"
FT                   /db_xref="GOA:P37872"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="SubtiList:BG10727"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37872"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11882.1"
FT                   /translation="MSEHYYSEKPSVKSNKQTWSFRLRNKDFTFTSDSGVFSKKEVDFG
FT                   SRLLIDSFEEPEVEGGILDVGCGYGPIGLSLASDFKDRTIHMIDVNERAVELSNENAEQ
FT                   NGITNVKIYQSDLFSNVDSAQTFASILTNPPIRAGKKVVHAIFEKSAEHLKASGELWIV
FT                   IQKKQGAPSAIEKLEELFDEVSVVQKKKGYYIIKAKKV"
     MSEHYYSEKP SVKSNKQTWS FRLRNKDFTF TSDSGVFSKK EVDFGSRLLI DSFEEPEVEG        60
     GILDVGCGYG PIGLSLASDF KDRTIHMIDV NERAVELSNE NAEQNGITNV KIYQSDLFSN       120
     VDSAQTFASI LTNPPIRAGK KVVHAIFEKS AEHLKASGEL WIVIQKKQGA PSAIEKLEEL       180
     FDEVSVVQKK KGYYIIKAKK V                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page