(data stored in SCRATCH zone)

EMBL: AL009126.RNMV

AL009126.RNMV        Location/Qualifiers
FT   CDS             50087..50647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BSU_00410"
FT                   /old_locus_tag="BSU00410"
FT                   /product="ribonuclease M5"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.1.26.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11233981, 11976317, 12794188,
FT                   16077031; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11817"
FT                   /db_xref="GOA:P37547"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="SubtiList:BG10104"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37547"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11233981, 11976317, 12794188, 16077031"
FT                   /protein_id="CAB11817.1"
FT                   /translation="MKIKEIIVVEGRDDTARIKLAVDADTIETNGSAIDDHVIDQIRLA
FT                   QKTRGVIILTDPDFPGEKIRKTISEAVPGCKHAFLPKHLAKPKNKRGIGVEHASVESIR
FT                   ACLENVHEEMEAQPSDISAEDLIHAGLIGGPAAKCRRERLGDLLKIGYTNGKQLQKRLQ
FT                   MFQIKKSDFMSALDTVMREEQNE"
     MKIKEIIVVE GRDDTARIKL AVDADTIETN GSAIDDHVID QIRLAQKTRG VIILTDPDFP        60
     GEKIRKTISE AVPGCKHAFL PKHLAKPKNK RGIGVEHASV ESIRACLENV HEEMEAQPSD       120
     ISAEDLIHAG LIGGPAAKCR RERLGDLLKI GYTNGKQLQK RLQMFQIKKS DFMSALDTVM       180
     REEQNE                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page