(data stored in SCRATCH zone)

EMBL: AL009126.RPLA

AL009126.RPLA        Location/Qualifiers
FT   CDS             119111..119809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BSU_01030"
FT                   /old_locus_tag="BSU01030"
FT                   /product="ribosomal protein L1 (BL1)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 16352840, 17981968,
FT                   22720735; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11879"
FT                   /db_xref="GOA:Q06797"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06797"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11879.2"
FT                   /translation="MAKKGKKYVEAAKLVDRSKAYDVSEAVALVKKTNTAKFDATVEVA
FT                   FRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDTDYINKI
FT                   QQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGV
FT                   KVDSSTFNVK"
     MAKKGKKYVE AAKLVDRSKA YDVSEAVALV KKTNTAKFDA TVEVAFRLGV DPRKNDQQIR        60
     GAVVLPNGTG KTQRVLVFAK GEKAKEAEAA GADFVGDTDY INKIQQGWFD FDVIVATPDM       120
     MGEVGKIGRV LGPKGLMPNP KTGTVTFEVE KAIGEIKAGK VEYRVDKAGN IHVPIGKVSF       180
     EDEKLVENFT TMYDTILKAK PAAAKGVYVK NVAVTSTMGP GVKVDSSTFN VK               232
//

If you have problems or comments...

PBIL Back to PBIL home page