(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLB

AL009126.RPLB        Location/Qualifiers
FT   CDS             137311..138144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BSU_01190"
FT                   /old_locus_tag="BSU01190"
FT                   /product="ribosomal protein L2 (BL2)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 23249812, 24637032;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11895"
FT                   /db_xref="GOA:P42919"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11217"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42919"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 23249812, 24637032"
FT                   /protein_id="CAB11895.2"
FT                   /translation="MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNN
FT                   QGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYI
FT                   LAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK"
     MAIKKYKPTS NGRRGMTTSD FAEITTDKPE KSLLAPLHKK GGRNNQGKLT VRHQGGGHKR        60
     QYRVIDFKRD KDGIPGRVAT VEYDPNRSAN IALINYADGE KRYILAPKGI QVGTEIMSGP       120
     EADIKVGNAL PLINIPVGTV VHNIELKPGK GGQLVRSAGT SAQVLGKEGK YVLVRLNSGE       180
     VRMILSACRA SIGQVGNEQH ELINIGKAGR SRWKGIRPTV RGSVMNPNDH PHGGGEGRAP       240
     IGRKSPMSPW GKPTLGFKTR KKKNKSDKFI VRRRKNK                                277
//

If you have problems or comments...

PBIL Back to PBIL home page