(data stored in SCRATCH zone)

EMBL: AL009126.RPLC

AL009126.RPLC        Location/Qualifiers
FT   CDS             135712..136341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BSU_01160"
FT                   /old_locus_tag="BSU01160"
FT                   /product="ribosomal protein L3 (BL3)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 17981968, 19154332,
FT                   23759864; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11892"
FT                   /db_xref="GOA:P42920"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11218"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42920"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 17981968, 19154332, 23759864"
FT                   /protein_id="CAB11892.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDG
FT                   YEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSA
FT                   GEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGR
FT                   MGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK"
     MTKGILGRKI GMTQVFAENG DLIPVTVIEA APNVVLQKKT AENDGYEAIQ LGFDDKREKL        60
     SNKPEKGHVA KAETAPKRFV KELRGVEMDA YEVGQEVKVE IFSAGEIVDV TGVSKGKGFQ       120
     GAIKRHGQSR GPMSHGSRYH RRPGSMGPVD PNRVFKGKLL PGRMGGEQIT VQNLEIVKVD       180
     AERNLLLIKG NVPGAKKSLI TVKSAVKSK                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page