(data stored in SCRATCH zone)

EMBL: AL009126.RPLD

AL009126.RPLD        Location/Qualifiers
FT   CDS             136369..136992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BSU_01170"
FT                   /old_locus_tag="BSU01170"
FT                   /product="ribosomal protein L4"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10898684, 12682299, 22720735;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11893"
FT                   /db_xref="GOA:P42921"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11219"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42921"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11893.1"
FT                   /translation="MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKK
FT                   VRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAV
FT                   ALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEKVEEVLA"
     MPKVALYNQN GSTAGDIELN ASVFGIEPNE SVVFDAILMQ RASLRQGTHK VKNRSEVRGG        60
     GRKPWRQKGT GRARQGSIRS PQWRGGGVVF GPTPRSYSYK LPKKVRRLAI KSVLSSKVID       120
     NNIIVLEDLT LDTAKTKEMA AILKGLSVEK KALIVTADAN EAVALSARNI PGVTVVEANG       180
     INVLDVVNHE KLLITKAAVE KVEEVLA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page