(data stored in SCRATCH zone)

EMBL: AL009126.RPLE

AL009126.RPLE        Location/Qualifiers
FT   CDS             141195..141734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BSU_01280"
FT                   /old_locus_tag="BSU01280"
FT                   /product="ribosomal protein L5 (BL6)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11904"
FT                   /db_xref="GOA:P12877"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10760"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12877"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11904.1"
FT                   /translation="MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQVGMPFQK"
     MNRLKEKYNK EIAPALMTKF NYDSVMQVPK IEKIVINMGV GDAVQNAKAI DSAVEELTFI        60
     AGQKPVVTRA KKSIAGFRLR EGMPIGAKVT LRGERMYDFL DKLISVSLPR VRDFRGVSKK       120
     SFDGRGNYTL GIKEQLIFPE IDYDKVTKVR GMDIVIVTTA NTDEEARELL TQVGMPFQK        179
//

If you have problems or comments...

PBIL Back to PBIL home page