(data stored in SCRATCH zone)

EMBL: AL009126.RPLF

AL009126.RPLF        Location/Qualifiers
FT   CDS             142402..142941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BSU_01310"
FT                   /old_locus_tag="BSU01310"
FT                   /product="ribosomal protein L6 (BL8)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 25330043; Product type
FT                   s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11907"
FT                   /db_xref="GOA:P46898"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11408"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46898"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11907.1"
FT                   /translation="MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIK
FT                   VEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKL
FT                   VLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGI
FT                   RYEGEVVRRKEGKSAK"
     MSRVGKKLLE IPSDVTVTLN DNNTVAVKGP KGELTRTFHP DMEIKVEDNV LTVARPSDQK        60
     EHRALHGTTR SLLGNMVEGV SKGFERGLEL VGVGYRASKS GNKLVLNVGY SHPVEIVPEE       120
     GIEIEVPSQT KVVVKGTDKE RVGAIAANIR AVRSPEPYKG KGIRYEGEVV RRKEGKSAK        179
//

If you have problems or comments...

PBIL Back to PBIL home page