(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLJ

AL009126.RPLJ        Location/Qualifiers
FT   CDS             120061..120561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BSU_01040"
FT                   /old_locus_tag="BSU01040"
FT                   /product="ribosomal protein L10 (BL5)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9810686, 11341315, 12682299,
FT                   18247578, 26101249, 22720735; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11880"
FT                   /db_xref="GOA:P42923"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="SubtiList:BG11220"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42923"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9810686, 11341315, 12682299, 18247578, 26101249,
FT                   22720735"
FT                   /protein_id="CAB11880.2"
FT                   /translation="MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQL
FT                   REANVEFKVYKNTMTRRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHE
FT                   ALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALAAKAVAEQKEE
FT                   QGA"
     MSSAIETKKV VVEEIASKLK ESKSTIIVDY RGLNVSEVTE LRKQLREANV EFKVYKNTMT        60
     RRAVEQAELN GLNDFLTGPN AIAFSTEDVV APAKVLNDFA KNHEALEIKA GVIEGKVSTV       120
     EEVKALAELP SREGLLSMLL SVLQAPVRNL ALAAKAVAEQ KEEQGA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page