(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLK

AL009126.RPLK        Location/Qualifiers
FT   CDS             118591..119016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BSU_01020"
FT                   /old_locus_tag="BSU01020"
FT                   /product="ribosomal protein L11 (BL11)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11244072, 19653700, 20441189;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11878"
FT                   /db_xref="GOA:Q06796"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="SubtiList:BG10163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06796"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11244072, 19653700, 20441189"
FT                   /protein_id="CAB11878.2"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
     MAKKVVKVVK LQIPAGKANP APPVGPALGQ AGVNIMGFCK EFNARTADQA GLIIPVEISV        60
     YEDRSFTFIT KTPPAAVLLK KAAGIESGSG EPNRNKVATV KRDKVREIAE TKMPDLNAAD       120
     VEAAMRMVEG TARSMGIVIE D                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page