(data stored in SCRATCH zone)

EMBL: AL009126.RPLL

AL009126.RPLL        Location/Qualifiers
FT   CDS             120607..120978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BSU_01050"
FT                   /old_locus_tag="BSU01050"
FT                   /product="ribosomal protein L12 (BL9)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 6771249, 8755892,
FT                   26101249; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11881"
FT                   /db_xref="GOA:P02394"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="SubtiList:BG10726"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02394"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 6771249, 8755892, 26101249"
FT                   /protein_id="CAB11881.1"
FT                   /translation="MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGA
FT                   AAGGAAEEQSEFDLILAGAGSQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKE
FT                   EAEELKAKLEEVGASVEVK"
     MALNIEEIIA SVKEATVLEL NDLVKAIEEE FGVTAAAPVA VAGGAAAGGA AEEQSEFDLI        60
     LAGAGSQKIK VIKVVREITG LGLKEAKELV DNTPKPLKEG IAKEEAEELK AKLEEVGASV       120
     EVK                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page