(data stored in SCRATCH zone)

EMBL: AL009126.RPLM

AL009126.RPLM        Location/Qualifiers
FT   CDS             153842..154279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BSU_01490"
FT                   /old_locus_tag="BSU01490"
FT                   /product="ribosomal protein L13"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10781545, 12682299, 23504016,
FT                   22720735; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11925"
FT                   /db_xref="GOA:P70974"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11970"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70974"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10781545, 12682299, 23504016, 22720735"
FT                   /protein_id="CAB11925.2"
FT                   /translation="MRTTPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTY
FT                   TPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLEL
FT                   AIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG"
     MRTTPMANAS TIERKWLVVD AAGKTLGRLS SEVAAILRGK HKPTYTPHVD TGDHVIIINA        60
     EKIELTGKKL TDKIYYRHTQ HPGGLKSRTA LEMRTNYPEK MLELAIKGML PKGSLGRQMF       120
     KKLNVYRGSE HPHEAQKPEV YELRG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page