(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLNA

AL009126.RPLNA       Location/Qualifiers
FT   CDS             140451..140819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplNA"
FT                   /locus_tag="BSU_01260"
FT                   /old_locus_tag="BSU01260"
FT                   /product="ribosomal protein L14"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8722036, 8805509, 12682299,
FT                   22829778; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11902"
FT                   /db_xref="GOA:P12875"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10758"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12875"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8722036, 8805509, 12682299, 22829778"
FT                   /protein_id="CAB11902.1"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRENNFMKIVSLAPEVI"
     MIQQETRLKV ADNSGAREVL TIKVLGGSGR KTANIGDVIV CTVKQATPGG VVKKGEVVKA        60
     VIVRTKSGAR RSDGSYISFD ENACVIIRDD KSPRGTRIFG PVARELRENN FMKIVSLAPE       120
     VI                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page