(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLO

AL009126.RPLO        Location/Qualifiers
FT   CDS             144085..144525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BSU_01350"
FT                   /old_locus_tag="BSU01350"
FT                   /product="ribosomal protein L15"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 15855514, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11911"
FT                   /db_xref="GOA:P19946"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10444"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19946"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 15855514, 23002217"
FT                   /protein_id="CAB11911.1"
FT                   /translation="MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISK
FT                   LNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI"
     MKLHELKPSE GSRKTRNRVG RGIGSGNGKT AGKGHKGQNA RSGGGVRPGF EGGQMPLFQR        60
     LPKRGFTNIN RKEYAVVNLD KLNGFAEGTE VTPELLLETG VISKLNAGVK ILGNGKLEKK       120
     LTVKANKFSA SAKEAVEAAG GTAEVI                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page