(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLP

AL009126.RPLP        Location/Qualifiers
FT   CDS             139500..139934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BSU_01230"
FT                   /old_locus_tag="BSU01230"
FT                   /product="ribosomal protein L16"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 16390447, 24335279;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01230"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11899"
FT                   /db_xref="GOA:P14577"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10755"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14577"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 16390447, 24335279"
FT                   /protein_id="CAB11899.1"
FT                   /translation="MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLF
FT                   EISGVSEEVAREALRLASHKLPIKTKFVKREEIGGESNES"
     MLLPKRVKYR REHRGKMRGR AKGGTEVHFG EFGIQALEAS WITNRQIEAA RIAMTRYMKR        60
     GGKVWIKIFP SKPYTAKPLE VRMGSGKGAP EGWVAVVKPG KVLFEISGVS EEVAREALRL       120
     ASHKLPIKTK FVKREEIGGE SNES                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page