(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLQ

AL009126.RPLQ        Location/Qualifiers
FT   CDS             149953..150315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BSU_01440"
FT                   /old_locus_tag="BSU01440"
FT                   /product="ribosomal protein L17 (BL15)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 6801428, 10717392, 12682299;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11920"
FT                   /db_xref="GOA:P20277"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20277"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:6801428, 10717392, 12682299"
FT                   /protein_id="CAB11920.1"
FT                   /translation="MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRIMKL
FT                   GPRRGDGAPMAIIELV"
     MSYRKLGRTS AQRKAMLRDL TTDLIINERI ETTETRAKEL RSVVEKMITL GKRGDLHARR        60
     QAAAYIRNEV ANEENNQDAL QKLFSDIATR YEERQGGYTR IMKLGPRRGD GAPMAIIELV       120
//

If you have problems or comments...

PBIL Back to PBIL home page