(data stored in SCRATCH zone)

EMBL: AL009126.RPLV

AL009126.RPLV        Location/Qualifiers
FT   CDS             138497..138838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BSU_01210"
FT                   /old_locus_tag="BSU01210"
FT                   /product="ribosomal protein L22 (BL17)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7928988, 12682299, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11897"
FT                   /db_xref="GOA:P42060"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42060"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7928988, 12682299, 23002217"
FT                   /protein_id="CAB11897.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASP
FT                   IIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   IVVSEKKEG"
     MQAKAVARTV RIAPRKARLV MDLIRGKQVG EAVSILNLTP RAASPIIEKV LKSAIANAEH        60
     NYEMDANNLV ISQAFVDEGP TLKRFRPRAM GRASQINKRT SHITIVVSEK KEG              113
//

If you have problems or comments...

PBIL Back to PBIL home page