(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLW

AL009126.RPLW        Location/Qualifiers
FT   CDS             136992..137279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BSU_01180"
FT                   /old_locus_tag="BSU01180"
FT                   /product="ribosomal protein L23"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 17981968, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11894"
FT                   /db_xref="GOA:P42924"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11221"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42924"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 17981968, 23002217"
FT                   /protein_id="CAB11894.2"
FT                   /translation="MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVES
FT                   IFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA"
     MKDPRDVLKR PVITERSADL MTEKKYTFEV DVRANKTEVK DAVESIFGVK VDKVNIMNYK        60
     GKSKRVGRYT GMTSRRRKAI VKLTADSKEI EIFEA                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page