(data stored in SCRATCH zone)

EMBL: AL009126.RPLX

AL009126.RPLX        Location/Qualifiers
FT   CDS             140857..141168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BSU_01270"
FT                   /old_locus_tag="BSU01270"
FT                   /product="ribosomal protein L24 (BL23)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11278078, 12682299; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11903"
FT                   /db_xref="GOA:P0CI78"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10759"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI78"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11278078, 12682299"
FT                   /protein_id="CAB11903.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHS
FT                   KPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK"
     MHVKKGDKVM VISGKDKGKQ GTILAAFPKK DRVLVEGVNM VKKHSKPTQA NPQGGISNQE        60
     APIHVSNVMP LDPKTGEVTR VGYKVEDGKK VRVAKKSGQV LDK                         103
//

If you have problems or comments...

PBIL Back to PBIL home page