(data stored in ACNUC7421 zone)

EMBL: AL009126.RPMD

AL009126.RPMD        Location/Qualifiers
FT   CDS             143875..144054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BSU_01340"
FT                   /old_locus_tag="BSU01340"
FT                   /product="ribosomal protein L30 (BL27)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11910"
FT                   /db_xref="GOA:P19947"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10443"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19947"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11910.1"
FT                   /translation="MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRG
FT                   MINKVSHLVSVKEQ"
     MAKLEITLKR SVIGRPEDQR VTVRTLGLKK TNQTVVHEDN AAIRGMINKV SHLVSVKEQ         59
//

If you have problems or comments...

PBIL Back to PBIL home page