(data stored in ACNUC7421 zone)

EMBL: AL009126.RPOA

AL009126.RPOA        Location/Qualifiers
FT   CDS             148931..149875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BSU_01430"
FT                   /old_locus_tag="BSU01430"
FT                   /product="RNA polymerase (alpha subunit)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1484484, 6811591, 9594570,
FT                   10972808, 12682299, 22720735; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11919"
FT                   /db_xref="GOA:P20429"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="PDB:1Z3E"
FT                   /db_xref="PDB:3GFK"
FT                   /db_xref="PDB:3IHQ"
FT                   /db_xref="SubtiList:BG10732"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20429"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1484484, 6811591, 9594570, 10972808, 12682299,
FT                   22720735"
FT                   /protein_id="CAB11919.1"
FT                   /translation="MIEIEKPKIETVEISDDAKFGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILHIKKLALKIYSDEEKTLEIDVQGE
FT                   GTVTAADITHDSDVEILNPDLHIATLGENASFRVRLTAQRGRGYTPADANKRDDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVANYDKLTLDVWTDGSTGPKEAIALGSKILTEHLN
FT                   IFVGLTDEAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLGLRKDD"
     MIEIEKPKIE TVEISDDAKF GKFVVEPLER GYGTTLGNSL RRILLSSLPG AAVTSIQIDG        60
     VLHEFSTIEG VVEDVTTIIL HIKKLALKIY SDEEKTLEID VQGEGTVTAA DITHDSDVEI       120
     LNPDLHIATL GENASFRVRL TAQRGRGYTP ADANKRDDQP IGVIPIDSIY TPVSRVSYQV       180
     ENTRVGQVAN YDKLTLDVWT DGSTGPKEAI ALGSKILTEH LNIFVGLTDE AQHAEIMVEK       240
     EEDQKEKVLE MTIEELDLSV RSYNCLKRAG INTVQELANK TEEDMMKVRN LGRKSLEEVK       300
     AKLEELGLGL RKDD                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page