(data stored in ACNUC7421 zone)

EMBL: AL009126.RPOC

AL009126.RPOC        Location/Qualifiers
FT   CDS             125562..129161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BSU_01080"
FT                   /old_locus_tag="BSU01080"
FT                   /product="RNA polymerase (beta' subunit)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10672039, 10675340, 10910724,
FT                   11029421, 9795209, 10438769, 23070162, 22720735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11884"
FT                   /db_xref="GOA:P37871"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="SubtiList:BG10729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37871"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10672039, 10675340, 10910724, 11029421, 9795209,
FT                   10438769, 23070162, 22720735"
FT                   /protein_id="CAB11884.2"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYG
FT                   NKFQASMGAEAIHKLLQDIDLVKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFK
FT                   NTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFP
FT                   YMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPFKKGILGKIIAEIFKRFHITE
FT                   TSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITE
FT                   EERYERVISIWSAAKDVIQGKLMKSLDELNPIYMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRETDCGTDRGILAKPLKEGTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDED
FT                   KALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGSDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATITEIDGTVVEINEVRDKQQ
FT                   EIVVQGAVETRSYTAPYNSRLKVAEGDKITRGQVLTEGSIDPKELLKVTDLTTVQEYLL
FT                   HEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVL
FT                   LEGNRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMMKYRKVKPVSNVQPTDDMVPVE"
     MLDVNNFEYM NIGLASPDKI RSWSFGEVKK PETINYRTLK PEKDGLFCER IFGPTKDWEC        60
     HCGKYKRVRY KGVVCDRCGV EVTRAKVRRE RMGHIELAAP VSHIWYFKGI PSRMGLVLDM       120
     SPRALEEVIY FASYVVTDPA NTPLEKKQLL SEKEYRAYLD KYGNKFQASM GAEAIHKLLQ       180
     DIDLVKEVDM LKEELKTSQG QRRTRAIKRL EVLEAFRNSG NKPSWMILDV LPVIPPELRP       240
     MVQLDGGRFA TSDLNDLYRR VINRNNRLKR LLDLGAPSII VQNEKRMLQE AVDALIDNGR       300
     RGRPVTGPGN RPLKSLSHML KGKQGRFRQN LLGKRVDYSG RSVIVVGPHL KMYQCGLPKE       360
     MALELFKPFV MKELVEKGLA HNIKSAKRKI ERVQPEVWDV LESVIKEHPV LLNRAPTLHR       420
     LGIQAFEPTL VEGRAIRLHP LVCTAYNADF DGDQMAVHVP LSAEAQAEAR ILMLAAQNIL       480
     NPKDGKPVVT PSQDMVLGNY YLTLERAGAV GEGMVFKNTD EALLAYQNGY VHLHTRVAVA       540
     ANSLKNVTFT EEQRSKLLIT TVGKLVFNEI LPESFPYMNE PTKSNIEEKT PDRFFLEKGA       600
     DVKAVIAQQP INAPFKKGIL GKIIAEIFKR FHITETSKML DRMKNLGFKY STKAGITVGV       660
     SDIVVLDDKQ EILEEAQSKV DNVMKQFRRG LITEEERYER VISIWSAAKD VIQGKLMKSL       720
     DELNPIYMMS DSGARGNASN FTQLAGMRGL MANPAGRIIE LPIKSSFREG LTVLEYFIST       780
     HGARKGLADT ALKTADSGYL TRRLVDVAQD VIIRETDCGT DRGILAKPLK EGTETIERLE       840
     ERLIGRFARK QVKHPETGEV LVNENELIDE DKALEIVEAG IEEVWIRSAF TCNTPHGVCK       900
     RCYGRNLATG SDVEVGEAVG IIAAQSIGEP GTQLTMRTFH TGGVAGDDIT QGLPRIQELF       960
     EARNPKGQAT ITEIDGTVVE INEVRDKQQE IVVQGAVETR SYTAPYNSRL KVAEGDKITR      1020
     GQVLTEGSID PKELLKVTDL TTVQEYLLHE VQKVYRMQGV EIGDKHVEVM VRQMLRKVRV      1080
     IDAGDTDVLP GTLLDIHQFT EANKKVLLEG NRPATGRPVL LGITKASLET DSFLSAASFQ      1140
     ETTRVLTDAA IKGKRDELLG LKENVIIGKL VPAGTGMMKY RKVKPVSNVQ PTDDMVPVE       1199
//

If you have problems or comments...

PBIL Back to PBIL home page