(data stored in ACNUC7421 zone)

EMBL: AL009126.RPSG

AL009126.RPSG        Location/Qualifiers
FT   CDS             130160..130630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BSU_01110"
FT                   /old_locus_tag="BSU01110"
FT                   /product="ribosomal protein S7 (BS7)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8722036, 12682299, 19653700;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11887"
FT                   /db_xref="GOA:P21469"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21469"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8722036, 12682299, 19653700"
FT                   /protein_id="CAB11887.2"
FT                   /translation="MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYK
FT                   SFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
     MPRKGPVAKR DVLPDPIYNS KLVSRLINKM MIDGKKGKSQ TILYKSFDII KERTGNDAME        60
     VFEQALKNIM PVLEVKARRV GGANYQVPVE VRPERRTTLG LRWLVNYARL RGEKTMEERL       120
     ANEILDAANN TGAAVKKRED THKMAEANKA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page