(data stored in SCRATCH zone)

EMBL: AL009126.RPSH

AL009126.RPSH        Location/Qualifiers
FT   CDS             141974..142372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BSU_01300"
FT                   /old_locus_tag="BSU01300"
FT                   /product="ribosomal protein S8 (BS8)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11906"
FT                   /db_xref="GOA:P12879"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10762"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12879"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11906.2"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGF
FT                   IRDVEFVEDSKQGIIRVFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   IISTSQGVLTDKEARAKQAGGEVLAYVW"
     MVMTDPIADM LTRIRNANMV RHEKLEIPAS KLKREIAEIL KREGFIRDVE FVEDSKQGII        60
     RVFLKYGQNN ERVITGLKRI SKPGLRVYAK SNEVPRVLNG LGIAIISTSQ GVLTDKEARA       120
     KQAGGEVLAY VW                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page