(data stored in SCRATCH zone)

EMBL: AL009126.RPSI

AL009126.RPSI        Location/Qualifiers
FT   CDS             154300..154692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BSU_01500"
FT                   /old_locus_tag="BSU01500"
FT                   /product="ribosomal protein S9"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 19653700, 22720735;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11926"
FT                   /db_xref="GOA:P21470"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19007"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21470"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11926.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALI
FT                   EDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
     MAQVQYYGTG RRKSSVARVR LVPGEGRIVV NNREISEHIP SAALIEDIKQ PLTLTETAGT        60
     YDVLVNVHGG GLSGQAGAIR HGIARALLEA DPEYRTTLKR AGLLTRDARM KERKKYGLKG       120
     ARRAPQFSKR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page