(data stored in SCRATCH zone)

EMBL: AL009126.RPSK

AL009126.RPSK        Location/Qualifiers
FT   CDS             148359..148754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BSU_01420"
FT                   /old_locus_tag="BSU01420"
FT                   /product="ribosomal protein S11 (BS11)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10217780, 12682299, 22720735;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11918"
FT                   /db_xref="GOA:P04969"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10731"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04969"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10217780, 12682299, 22720735"
FT                   /protein_id="CAB11918.1"
FT                   /translation="MAAARKSNTRKRRVKKNIESGIAHIRSTFNNTIVTITDTHGNAIS
FT                   WSSAGALGFRGSRKSTPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQA
FT                   AGLEVTAIRDVTPVPHNGCRPPKRRRV"
     MAAARKSNTR KRRVKKNIES GIAHIRSTFN NTIVTITDTH GNAISWSSAG ALGFRGSRKS        60
     TPFAAQMAAE TAAKGSIEHG LKTLEVTVKG PGSGREAAIR ALQAAGLEVT AIRDVTPVPH       120
     NGCRPPKRRR V                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page