(data stored in SCRATCH zone)

EMBL: AL009126.RPSM

AL009126.RPSM        Location/Qualifiers
FT   CDS             147973..148338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BSU_01410"
FT                   /old_locus_tag="BSU01410"
FT                   /product="ribosomal protein S13"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 22720735; Product type
FT                   s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11917"
FT                   /db_xref="GOA:P20282"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10730"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20282"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11917.2"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIFGIGRTTAQQVLKEAGVSEDTRV
FT                   RDLTEEELGKIRDIIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
     MARIAGVDIP RDKRVVISLT YIFGIGRTTA QQVLKEAGVS EDTRVRDLTE EELGKIRDII        60
     DKLKVEGDLR REVSLNIKRL IEIGSYRGIR HRRGLPVRGQ NSKNNARTRK GPRRTVANKK       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page