(data stored in SCRATCH zone)

EMBL: AL009126.RPSQ

AL009126.RPSQ        Location/Qualifiers
FT   CDS             140147..140410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BSU_01250"
FT                   /old_locus_tag="BSU01250"
FT                   /product="ribosomal protein S17 (BS16)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299; Product type s:
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11901"
FT                   /db_xref="GOA:P12874"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12874"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299"
FT                   /protein_id="CAB11901.1"
FT                   /translation="MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKK
FT                   FKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII"
     MSERNQRKVY QGRVVSDKMD KTITVVVETY KKHTLYGKRV KYSKKFKAHD ENNQAKIGDI        60
     VKIMETRPLS ATKRFRLVEV VEEAVII                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page