(data stored in SCRATCH zone)

EMBL: AL009126.RSMA

AL009126.RSMA        Location/Qualifiers
FT   CDS             50640..51518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmA"
FT                   /locus_tag="BSU_00420"
FT                   /old_locus_tag="BSU00420"
FT                   /product="dimethyladenosine 16S ribosomal RNA transferase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 99430, 6801425, 11327780,
FT                   1690648, 22391551; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11818"
FT                   /db_xref="GOA:P37468"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:6IFS"
FT                   /db_xref="PDB:6IFT"
FT                   /db_xref="PDB:6IFV"
FT                   /db_xref="PDB:6IFW"
FT                   /db_xref="SubtiList:BG10105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37468"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11818.1"
FT                   /translation="MNKDIATPIRTKEILKKYGFSFKKSLGQNFLIDTNILNRIVDHAE
FT                   VTEKTGVIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILKDTLSPYENVTVIHQDVL
FT                   KADVKSVIEEQFQDCDEIMVVANLPYYVTTPIIMKLLEEHLPLKGIVVMLQKEVAERMA
FT                   ADPSSKEYGSLSIAVQFYTEAKTVMIVPKTVFVPQPNVDSAVIRLILRDGPAVDVENES
FT                   FFFQLIKASFAQRRKTLLNNLVNNLPEGKAQKSTIEQVLEETNIDGKRRGESLSIEEFA
FT                   ALSNGLYKALF"
     MNKDIATPIR TKEILKKYGF SFKKSLGQNF LIDTNILNRI VDHAEVTEKT GVIEIGPGIG        60
     ALTEQLAKRA KKVVAFEIDQ RLLPILKDTL SPYENVTVIH QDVLKADVKS VIEEQFQDCD       120
     EIMVVANLPY YVTTPIIMKL LEEHLPLKGI VVMLQKEVAE RMAADPSSKE YGSLSIAVQF       180
     YTEAKTVMIV PKTVFVPQPN VDSAVIRLIL RDGPAVDVEN ESFFFQLIKA SFAQRRKTLL       240
     NNLVNNLPEG KAQKSTIEQV LEETNIDGKR RGESLSIEEF AALSNGLYKA LF               292
//

If you have problems or comments...

PBIL Back to PBIL home page