(data stored in SCRATCH zone)

EMBL: AL009126.RSMI

AL009126.RSMI        Location/Qualifiers
FT   CDS             43921..44799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmI"
FT                   /locus_tag="BSU_00360"
FT                   /old_locus_tag="BSU00360"
FT                   /product="16S rRNA 2'-O-ribose C1402 methyltransferase"
FT                   /function="16.8: Protect"
FT                   /function="16.3: Control"
FT                   /EC_number="2.1.1.198"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16014871, 19965768, 25893373;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11812"
FT                   /db_xref="GOA:P37544"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="SubtiList:BG10099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37544"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11812.1"
FT                   /translation="MLRRQMSFNGKSDMGILYLVPTPIGNLEDMTFRAIDTLKSVDAIA
FT                   AEDTRQTKKLCHVYEIETPLVSYHEHNKESSGHKIIEWLKSGKNIALVSDAGLPTISDP
FT                   GAEIVKDFTDIGGYVVPLPGANAALTALIASGIVPQPFFFYGFLNRQKKEKKKELEALK
FT                   KRQETIIFYEAPHRLKETLSAMAEILGDREIAVTRELTKKYEEFIRGTISEVIGWANED
FT                   QIRGEFCLVVEGSNNEEVDEEEQWWETLTAKEHVEHYISKGATSKEAIKKAAVDRNVPK
FT                   REVYDAYHIKQ"
     MLRRQMSFNG KSDMGILYLV PTPIGNLEDM TFRAIDTLKS VDAIAAEDTR QTKKLCHVYE        60
     IETPLVSYHE HNKESSGHKI IEWLKSGKNI ALVSDAGLPT ISDPGAEIVK DFTDIGGYVV       120
     PLPGANAALT ALIASGIVPQ PFFFYGFLNR QKKEKKKELE ALKKRQETII FYEAPHRLKE       180
     TLSAMAEILG DREIAVTREL TKKYEEFIRG TISEVIGWAN EDQIRGEFCL VVEGSNNEEV       240
     DEEEQWWETL TAKEHVEHYI SKGATSKEAI KKAAVDRNVP KREVYDAYHI KQ               292
//

If you have problems or comments...

PBIL Back to PBIL home page