(data stored in SCRATCH zone)

EMBL: AL009126.SALA

AL009126.SALA        Location/Qualifiers
FT   CDS             157421..158479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salA"
FT                   /locus_tag="BSU_01540"
FT                   /old_locus_tag="BSU01540"
FT                   /product="phosphorylation-dependent (Y327) transcriptional
FT                   regulator"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11790741, 15126467, 26094643;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11930"
FT                   /db_xref="GOA:P50863"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="SubtiList:BG11494"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50863"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11790741, 15126467, 26094643"
FT                   /protein_id="CAB11930.1"
FT                   /translation="MIREDEVRKLVGEMREPFLQRPLGELDAVKEIKIKPEKRHISVKV
FT                   ALAKTGTAEQMQIQQEIVNVLKGAGAETVGLRFEELPEETVAKFRAPSAEKKTLLNMDN
FT                   PPVFLAVASGKGGVGKSTVSVNLAISLARLGKKVGLIDADIYGFSVPDMMGITVRPTIE
FT                   GEKLLPVERFGVKVMSMGFFVEENAPVVWRGPMLGKMLNNFFHEVEWGEVDYIVLDLPP
FT                   GTGDVALDVHTMLPSCKEIIVSTPHPTAAFVAARAGSMAIKTDHEVVGVIENMAYYESA
FT                   KTGEREYVFGKGGGDKLAEELNVPLLGRIPLKQPDWDKDQFAPSVYDENHPIGEIYQDI
FT                   AKKIDAKMSVQV"
     MIREDEVRKL VGEMREPFLQ RPLGELDAVK EIKIKPEKRH ISVKVALAKT GTAEQMQIQQ        60
     EIVNVLKGAG AETVGLRFEE LPEETVAKFR APSAEKKTLL NMDNPPVFLA VASGKGGVGK       120
     STVSVNLAIS LARLGKKVGL IDADIYGFSV PDMMGITVRP TIEGEKLLPV ERFGVKVMSM       180
     GFFVEENAPV VWRGPMLGKM LNNFFHEVEW GEVDYIVLDL PPGTGDVALD VHTMLPSCKE       240
     IIVSTPHPTA AFVAARAGSM AIKTDHEVVG VIENMAYYES AKTGEREYVF GKGGGDKLAE       300
     ELNVPLLGRI PLKQPDWDKD QFAPSVYDEN HPIGEIYQDI AKKIDAKMSV QV               352
//

If you have problems or comments...

PBIL Back to PBIL home page