(data stored in SCRATCH zone)

EMBL: AL009126.SECY

AL009126.SECY        Location/Qualifiers
FT   CDS             144527..145822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BSU_01360"
FT                   /old_locus_tag="BSU01360"
FT                   /product="preprotein translocase subunit"
FT                   /function="16.1: Circulate"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9917412, 15341641, 15849754,
FT                   16850406, 23852076, 22720735, 27336478; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11912"
FT                   /db_xref="GOA:P16336"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="SubtiList:BG10445"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16336"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9917412, 15341641, 15849754, 16850406, 23852076,
FT                   22720735, 27336478"
FT                   /protein_id="CAB11912.1"
FT                   /translation="MFKTISNFMRVSDIRNKIIFTLLMLIVFRIGAFIPVPYVNAEALQ
FT                   AQSQMGVFDLLNTFGGGALYQFSIFAMGITPYITASIIIQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNLANGMLIEKSGVSTYLIIALVLTGGTAFL
FT                   MWLGEQITSHGVGNGISIIIFAGIVSSIPKTIGQIYETQFVGSNDQLFIHIVKVALLVI
FT                   AILAVIVGVIFIQQAVRKIAIQYAKGTGRSPAGGGQSTHLPLKVNPAGVIPVIFAVAFL
FT                   ITPRTIASFFGTNDVTKWIQNNFDNTHPVGMAIYVALIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGVRPGKMTQDRITSILYRLTFVGSIFLAVISILPIFFIQFAGLPQSAQIGG
FT                   TSLLIVVGVALETMKQLESQLVKRNYRGFMKN"
     MFKTISNFMR VSDIRNKIIF TLLMLIVFRI GAFIPVPYVN AEALQAQSQM GVFDLLNTFG        60
     GGALYQFSIF AMGITPYITA SIIIQLLQMD VVPKFTEWSK QGEVGRRKLA QFTRYFTIVL       120
     GFIQALGMSY GFNNLANGML IEKSGVSTYL IIALVLTGGT AFLMWLGEQI TSHGVGNGIS       180
     IIIFAGIVSS IPKTIGQIYE TQFVGSNDQL FIHIVKVALL VIAILAVIVG VIFIQQAVRK       240
     IAIQYAKGTG RSPAGGGQST HLPLKVNPAG VIPVIFAVAF LITPRTIASF FGTNDVTKWI       300
     QNNFDNTHPV GMAIYVALII AFTYFYAFVQ VNPEQMADNL KKQGGYIPGV RPGKMTQDRI       360
     TSILYRLTFV GSIFLAVISI LPIFFIQFAG LPQSAQIGGT SLLIVVGVAL ETMKQLESQL       420
     VKRNYRGFMK N                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page