(data stored in SCRATCH zone)

EMBL: AL009126.SERS

AL009126.SERS        Location/Qualifiers
FT   CDS             20880..22157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BSU_00130"
FT                   /old_locus_tag="BSU00130"
FT                   /product="seryl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.11"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10546897, 12682299, 14732487;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11789"
FT                   /db_xref="GOA:P37464"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="SubtiList:BG10077"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37464"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10546897, 12682299, 14732487"
FT                   /protein_id="CAB11789.1"
FT                   /translation="MLDTKMLRANFQEIKAKLVHKGEDLTDFDKFEALDDRRRELIGKV
FT                   EELKGKRNEVSQQVAVLKREKKDADHIIKEMREVGEEIKKLDEELRTVEAELDTILLSI
FT                   PNIPHESVPVGETEDDNVEVRKWGEKPSFAYEPKPHWDIADELGILDFERAAKVTGSRF
FT                   VFYKGLGARLERALYNFMLDLHVDEYNYTEVIPPYMVNRASMTGTGQLPKFEEDAFKIR
FT                   EEDYFLIPTAEVPITNMHRDEILSGDSLPINYAAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNQAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSQDTYREISSCSNFEAFQARRANIRFRREAKGKPEHVHTLNGSGLAVGRTVAAILEN
FT                   YQQEDGSVVIPKVLRPYMGNREVMKP"
     MLDTKMLRAN FQEIKAKLVH KGEDLTDFDK FEALDDRRRE LIGKVEELKG KRNEVSQQVA        60
     VLKREKKDAD HIIKEMREVG EEIKKLDEEL RTVEAELDTI LLSIPNIPHE SVPVGETEDD       120
     NVEVRKWGEK PSFAYEPKPH WDIADELGIL DFERAAKVTG SRFVFYKGLG ARLERALYNF       180
     MLDLHVDEYN YTEVIPPYMV NRASMTGTGQ LPKFEEDAFK IREEDYFLIP TAEVPITNMH       240
     RDEILSGDSL PINYAAFSAC FRSEAGSAGR DTRGLIRQHQ FNKVELVKFV KPEDSYEELE       300
     KLTNQAERVL QLLELPYRVM SMCTGDLGFT AAKKYDIEVW IPSQDTYREI SSCSNFEAFQ       360
     ARRANIRFRR EAKGKPEHVH TLNGSGLAVG RTVAAILENY QQEDGSVVIP KVLRPYMGNR       420
     EVMKP                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page