(data stored in SCRATCH zone)

EMBL: AL009126.SIPU

AL009126.SIPU        Location/Qualifiers
FT   CDS             454029..454592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipU"
FT                   /locus_tag="BSU_04010"
FT                   /old_locus_tag="BSU04010"
FT                   /product="type I signal peptidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.1: Circulate"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.4.21.89"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9325333, 10198007, 11856304,
FT                   14568161; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12209"
FT                   /db_xref="GOA:P42959"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="SubtiList:BG11223"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42959"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9325333, 10198007, 11856304, 14568161"
FT                   /protein_id="CAB12209.1"
FT                   /translation="MNAKTITLKKKRKIKTIVVLSIIMIAALIFTIRLVFYKPFLIEGS
FT                   SMAPTLKDSERILVDKAVKWTGGFHRGDIIVIHDKKSGRSFVKRLIGLPGDSIKMKNDQ
FT                   LYINDKKVEEPYLKEYKQEVKESGVTLTGDFEVEVPSGKYFVMGDNRLNSLDSRNGMGM
FT                   PSEDDIIGTESLVFYPFGEMRQAK"
     MNAKTITLKK KRKIKTIVVL SIIMIAALIF TIRLVFYKPF LIEGSSMAPT LKDSERILVD        60
     KAVKWTGGFH RGDIIVIHDK KSGRSFVKRL IGLPGDSIKM KNDQLYINDK KVEEPYLKEY       120
     KQEVKESGVT LTGDFEVEVP SGKYFVMGDN RLNSLDSRNG MGMPSEDDII GTESLVFYPF       180
     GEMRQAK                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page