(data stored in ACNUC7421 zone)

EMBL: AL009126.SKFE

AL009126.SKFE        Location/Qualifiers
FT   CDS             216913..217632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfE"
FT                   /locus_tag="BSU_01950"
FT                   /old_locus_tag="BSU01950"
FT                   /product="sporulation killing factor biosynthesis and
FT                   export; ABC transporter (binding protein)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 26284661; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11989"
FT                   /db_xref="GOA:O31427"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12718"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:26284661"
FT                   /protein_id="CAB11989.1"
FT                   /translation="MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTT
FT                   IRCLTGLYKPDKGDILIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHP
FT                   GKKDVKERVYHALKEVHLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGL
FT                   DIPSKQWLSNWLKTKTDQGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQ
FT                   AEWRKEVIRLLGEWSDE"
     MQLMQVQNLS KCYRNGDGVE HLSFSIQRGE IVALLGPNGA GKTTTIRCLT GLYKPDKGDI        60
     LIEGSPPGDI NVQKKVALIP DQPYLYPALT AAEHIQFRAR GYHPGKKDVK ERVYHALKEV       120
     HLEEKANQLC GQLSRGQKQR VVLAGAIVQD ALLYILDEPT VGLDIPSKQW LSNWLKTKTD       180
     QGCSAFVSTH SLEFVIETAD RVILIRDGKL MQDLYVPQFE EQAEWRKEVI RLLGEWSDE        239
//

If you have problems or comments...

PBIL Back to PBIL home page