(data stored in SCRATCH zone)

EMBL: AL009126.SLEL

AL009126.SLEL        Location/Qualifiers
FT   CDS             complement(23868..25151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sleL"
FT                   /locus_tag="BSU_00160"
FT                   /old_locus_tag="BSU00160"
FT                   /product="spore peptidoglycan N-acetylglucosaminidase"
FT                   /function="16.13: Shape"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 11011148, 11737650, 12177332,
FT                   10419957, 18456807, 18835992, 19933362, 28333204; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11792"
FT                   /db_xref="GOA:P37531"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="SubtiList:BG10080"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37531"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11792.1"
FT                   /translation="MVKQGDTLSAIASQYRTTTNDITETNEIPNPDSLVVGQTIVIPIA
FT                   GQFYDVKRGDTLTSIARQFNTTAAELARVNRIQLNTVLQIGFRLYIPPAPKRDIESNAY
FT                   LEPRGNQVSENLQQAAREASPYLTYLGAFSFQAQRNGTLVAPPLTNLRSITESQNTTLM
FT                   MIITNLENQAFSDELGRILLNDETVKRRLLNEIVENARRYGFRDIHFDFEYLRPQDREA
FT                   YNQFLREARDLFHREGLEISTALAPKTSATQQGRWYEAHDYRAHGEIVDFVVLMTYEWG
FT                   YSGGPPQAVSPIGPVRDVIEYALTEMPANKIVMGQNLYGYDWTLPYTAGGTPARAVSPQ
FT                   QAIVIADQNNASIQYDQTAQAPFFRYTDAENRRHEVWFEDARSIQAKFNLIKELNLRGI
FT                   SYWKLGLSFPQNWLLLSDQFNVVKKTFR"
     MVKQGDTLSA IASQYRTTTN DITETNEIPN PDSLVVGQTI VIPIAGQFYD VKRGDTLTSI        60
     ARQFNTTAAE LARVNRIQLN TVLQIGFRLY IPPAPKRDIE SNAYLEPRGN QVSENLQQAA       120
     REASPYLTYL GAFSFQAQRN GTLVAPPLTN LRSITESQNT TLMMIITNLE NQAFSDELGR       180
     ILLNDETVKR RLLNEIVENA RRYGFRDIHF DFEYLRPQDR EAYNQFLREA RDLFHREGLE       240
     ISTALAPKTS ATQQGRWYEA HDYRAHGEIV DFVVLMTYEW GYSGGPPQAV SPIGPVRDVI       300
     EYALTEMPAN KIVMGQNLYG YDWTLPYTAG GTPARAVSPQ QAIVIADQNN ASIQYDQTAQ       360
     APFFRYTDAE NRRHEVWFED ARSIQAKFNL IKELNLRGIS YWKLGLSFPQ NWLLLSDQFN       420
     VVKKTFR                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page