(data stored in SCRATCH zone)

EMBL: AL009126.SPCP

AL009126.SPCP        Location/Qualifiers
FT   CDS             68216..68518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spcP"
FT                   /locus_tag="BSU_00600"
FT                   /old_locus_tag="BSU00600"
FT                   /product="spore protein involved in the shaping of the
FT                   spore coat"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10869437, 11283287, 15231775,
FT                   21904870, 22720735; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11836"
FT                   /db_xref="GOA:P37558"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="SubtiList:BG10123"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37558"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10869437, 11283287, 15231775, 21904870, 22720735"
FT                   /protein_id="CAB11836.1"
FT                   /translation="MNSYYDQKGSSSVPEQHDVTMKGRKHLDISGVKHVESFDNEEFLL
FT                   ETVMGMLSVRGQNLQMKNLDVEKGIVSIKGRVFDLVYLDEQQGDKAKGFFSKLFK"
     MNSYYDQKGS SSVPEQHDVT MKGRKHLDIS GVKHVESFDN EEFLLETVMG MLSVRGQNLQ        60
     MKNLDVEKGI VSIKGRVFDL VYLDEQQGDK AKGFFSKLFK                             100
//

If you have problems or comments...

PBIL Back to PBIL home page