(data stored in ACNUC7421 zone)

EMBL: AL009126.SPOIIE

AL009126.SPOIIE      Location/Qualifiers
FT   CDS             70538..73021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BSU_00640"
FT                   /old_locus_tag="BSU00640"
FT                   /product="SpoIIAA-phosphate serine phosphatase"
FT                   /function="16.13: Shape"
FT                   /function="16.3: Control"
FT                   /EC_number="3.1.3.16"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10747015, 12180929, 15126482,
FT                   15866939, 15978076, 28358838; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11840"
FT                   /db_xref="GOA:P37475"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:3T91"
FT                   /db_xref="PDB:3T9Q"
FT                   /db_xref="PDB:5MQH"
FT                   /db_xref="PDB:5UCG"
FT                   /db_xref="SubtiList:BG10127"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37475"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10747015, 12180929, 15126482, 15866939, 15978076,
FT                   28358838"
FT                   /protein_id="CAB11840.1"
FT                   /translation="MEKAERRVNGPMAGQALEKLQSFFNRGTKLVTHHLHSLFFYKGFI
FT                   YVVIGFLLGRAFILSEVLPFALPFFGAMLLIRRDKAFYAVLAVLAGALTISPKHSLLIL
FT                   AALLAFFVFSKVAAFITDDRVKALPIVVFFSMAAARAGFVYAQNGVFTTYDYVMAIVEA
FT                   GLSFILTLIFLQSLPIFTVKKVKQSLKIEEIICFMILIASVLTGLAGLSYQGMQAEHIL
FT                   ARYVVLSFSFIGGASIGCTVGVVTGLILGLANIGNLYQMSLLAFSGLLGGLLKEGKKAG
FT                   AAIGLIVGSLLISLYGEGSAGLMTTLYESLIAVCLFLLTPQSITRKVARYIPGTVEHLQ
FT                   EQQQYARKIRDVTAQKVDQFSNVFHALSESFATFYQASDEQTDDSEVDLFLSKITEHSC
FT                   QTCYKKNRCWVQNFDKTYDLMKQVMLETEEKEYASNRRLKKEFQQYCSKSKQVEELIED
FT                   ELAHHHAHLTLKKKVQDSRRLVAEQLLGVSEVMADFSREIKREREQHFLQEEQIIEALQ
FT                   HFGIEIQHVEIYSLEQGNIDIEMTIPFSGHGESEKIIAPMLSDILEEQILVKAEQHSPH
FT                   PNGYSHVAFGSTKSYRVSTGAAHAAKGGGLVSGDSYSMMELGARKYAAAISDGMGNGAR
FT                   AHFESNETIKLLEKILESGIDEKIAIKTINSILSLRTTDEIYSTLDLSIIDLQDASCKF
FT                   LKVGSTPSFIKRGDQVMKVQASNLPIGIINEFDVEVVSEQLKAGDLLIMMSDGIFEGPK
FT                   HVENHDLWMKRKMKGLKTNDPQEIADLLMEEVIRTRSGQIEDDMTVVVVRIDHNTPKWA
FT                   SIPVPAIFQNKQEIS"
     MEKAERRVNG PMAGQALEKL QSFFNRGTKL VTHHLHSLFF YKGFIYVVIG FLLGRAFILS        60
     EVLPFALPFF GAMLLIRRDK AFYAVLAVLA GALTISPKHS LLILAALLAF FVFSKVAAFI       120
     TDDRVKALPI VVFFSMAAAR AGFVYAQNGV FTTYDYVMAI VEAGLSFILT LIFLQSLPIF       180
     TVKKVKQSLK IEEIICFMIL IASVLTGLAG LSYQGMQAEH ILARYVVLSF SFIGGASIGC       240
     TVGVVTGLIL GLANIGNLYQ MSLLAFSGLL GGLLKEGKKA GAAIGLIVGS LLISLYGEGS       300
     AGLMTTLYES LIAVCLFLLT PQSITRKVAR YIPGTVEHLQ EQQQYARKIR DVTAQKVDQF       360
     SNVFHALSES FATFYQASDE QTDDSEVDLF LSKITEHSCQ TCYKKNRCWV QNFDKTYDLM       420
     KQVMLETEEK EYASNRRLKK EFQQYCSKSK QVEELIEDEL AHHHAHLTLK KKVQDSRRLV       480
     AEQLLGVSEV MADFSREIKR EREQHFLQEE QIIEALQHFG IEIQHVEIYS LEQGNIDIEM       540
     TIPFSGHGES EKIIAPMLSD ILEEQILVKA EQHSPHPNGY SHVAFGSTKS YRVSTGAAHA       600
     AKGGGLVSGD SYSMMELGAR KYAAAISDGM GNGARAHFES NETIKLLEKI LESGIDEKIA       660
     IKTINSILSL RTTDEIYSTL DLSIIDLQDA SCKFLKVGST PSFIKRGDQV MKVQASNLPI       720
     GIINEFDVEV VSEQLKAGDL LIMMSDGIFE GPKHVENHDL WMKRKMKGLK TNDPQEIADL       780
     LMEEVIRTRS GQIEDDMTVV VVRIDHNTPK WASIPVPAIF QNKQEIS                     827
//

If you have problems or comments...

PBIL Back to PBIL home page