(data stored in ACNUC7421 zone)

EMBL: AL009126.SRFAA

AL009126.SRFAA       Location/Qualifiers
FT   CDS             376968..387731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAA"
FT                   /locus_tag="BSU_03480"
FT                   /old_locus_tag="BSU03480"
FT                   /product="surfactin synthetase"
FT                   /function="16.8: Protect"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15066026, 16166527, 8288534,
FT                   8441623, 14762003, 16707694, 26284661, 26268540, 14762003;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12142"
FT                   /db_xref="GOA:P27206"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="SubtiList:BG10168"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27206"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15066026, 16166527, 8288534, 8441623, 14762003,
FT                   16707694, 26284661, 26268540, 14762003"
FT                   /protein_id="CAB12142.2"
FT                   /translation="MEITFYPLTDAQKRIWYTEKFYPHTSISNLAGIGKLVSADAIDYV
FT                   LVEQAIQEFIRRNDAMRLRLRLDENGEPVQYISEYRPVDIKHTDTTEDPNAIEFISQWS
FT                   REETKKPLPLYDCDLFRFSLFTIKENEVWFYANVHHVISDGISMNILGNAIMHIYLELA
FT                   SGSETKEGISHSFIDHVLSEQEYAQSKRFEKDKAFWNKQFESVPELVSLKRNASAGGSL
FT                   DAERFSKDVPEALHQQILSFCEANKVSVLSVFQSLLAAYLYRVSGQNDVVTGTFMGNRT
FT                   NAKEKQMLGMFVSTVPLRTNIDGGQAFSEFVKDRMKDLMKTLRHQKYPYNLLINDLRET
FT                   KSSLTKLFTVSLEYQVMQWQKEEDLAFLTEPIFSGSGLNDVSIHVKDRWDTGKLTIDFD
FT                   YRTDLFSREEINMICERMITMLENALTHPEHTIDELTLISDAEKEKLLARAGGKSVSYR
FT                   KDMTIPELFQEKAELLSDHPAVVFEDRTLSYRTLHEQSARIANVLKQKGVGPDSPVAVL
FT                   IERSERMITAIMGILKAGGAYVPIDPGFPAERIQYILEDCGADFILTESKVAAPEADAE
FT                   LIDLDQAIEEGAEESLNADVNARNLAYIIYTSGTTGRPKGVMIEHRQVHHLVESLQQTI
FT                   YQSGSQTLRMALLAPFHFDASVKQIFASLLLGQTLYIVPKKTVTNGAALTAYYRKNSIE
FT                   ATDGTPAHLQMLAAAGDFEGLKLKHMLIGGEGLSSVVADKLLKLFKEAGTAPRLTNVYG
FT                   PTETCVDASVHPVIPENAVQSAYVPIGKALGNNRLYILDQKGRLQPEGVAGELYIAGDG
FT                   VGRGYLHLPELTEEKFLQDPFVPGDRMYRTGDVVRWLPDGTIEYLGREDDQVKVRGYRI
FT                   ELGEIEAVIQQAPDVAKAVVLARPDEQGNLEVCAYVVQKPGSEFAPAGLREHAARQLPD
FT                   YMVPAYFTEVTEIPLTPSGKVDRRKLFALEVKAVSGTAYTAPRNETEKAIAAIWQDVLN
FT                   VEKAGIFDNFFETGGHSLKAMTLLTKIHKETGIEIPLQFLFEHPTITALAEEADHRESK
FT                   AFAVIEPAEKQEHYPLSLAQQRTYIVSQFEDAGVGYNMPAAAILEGPLDIQKLERAFQG
FT                   LIRRHESLRTSFVLENSTPRQKIHDSVDFNIEMIERGGRSDEAIMASFVRTFDLAKAPL
FT                   FRIGLLGLEENRHMLLFDMHHLISDGVSIGIMLEELARIYKGEQLPDLRLQYKDYAVWQ
FT                   SRQAAEGYKKDQAYWKEVFAGELPVLQLLSDYPRPPVQSFEGDRVSIKLDAGVKDRLNR
FT                   LAEQNGATLYMVMLSAYYTLLSKYTGQDDIIVGTPSAGRNHSDTEGIIGMFVNTLAIRS
FT                   EVKQNETFTQLISRVRKRVLDAFSHQDYPFEWLVEDLNIPRDVSRHPLFDTMFSLQNAT
FT                   EGIPAVGDLSLSVQETNFKIAKFDLTVQARETDEGIEIDVDYSTKLFKQSTADRLLTHF
FT                   ARLLEDAAADPEKPISEYKLLSEEEAASQIQQFNPGRTPYPKDKTIVQLFEEQAANTPD
FT                   HTALQYEGESLTYRELNERANRLARGILSLGAGEGRTAAVLCERSMDMIVSILAVLKSG
FT                   SAYVPIDPEHPIQRMQHFFRDSGAKVLLTQRKLKALAEEAEFKGVIVLADEEESYHADA
FT                   RNLALPLDSAAMANLTYTSGTTGTPKGNIVTHANILRTVKETNYLSITEQDTILGLSNY
FT                   VFDAFMFDMFGSLLNGAKLVLIPKETVLDMARLSRVIERENISILMITTALFHLLVDLN
FT                   PACLSTLRKIMFGGERASVEHVRKALQTVGKGKLLHMYGPSESTVFATYHPVDELEEHT
FT                   LSVPIGKPVSNTEVYILDRTGHVQPAGIAGELCVSGEGLVKGYYNRPELTEEKFVPHPF
FT                   TSGERMYKTGDLARWLPNGDIEFIGRIDHQVKIRGQRIELGEIEHQLQTHDRVQESVVL
FT                   AVDQGAGDKLLCAYYVGEGDISSQEMREHAAKDLPAYMVPAVFIQMDELPLTGNGKIDR
FT                   RALPIPDANVSRGVSYVAPRNGTEQKVADIWAQVLQAEQVGAYDHFFDIGGHSLAGMKM
FT                   LALVHQELGVELSLKDLFQSPTVEGLAQVIASAEKGTAASISPAEKQDTYPVSSPQKRM
FT                   YVLQQLEDAQTSYNMPAVLRLTGELDVERLNSVMQQLMQRHEALRTTFEIKDGETVQRI
FT                   WEEAECEIAYFEAPEEETERIVSEFIKPFKIDQLPLFRIGLIKHSDTEHVLLFDMHHII
FT                   SDGASVGVLIEELSKLYDGETLEPLRIQYKDYAVWQQQFIQSELYKKQEEHWLKELDGE
FT                   LPVLTLPTDYSRPAVQTFEGDRIAFSLEAGKADALRRLAKETDSTLYMVLLASYSAFLS
FT                   KISGQDDIIVGSPVAGRSQADVSRVIGMFVNTLALRTYPKGEKTFADYLNEVKETALSA
FT                   FDAQDYPLEDLIGNVQVQRDTSRNPLFDAVFSMQNANIKDLTMKGIQLEPHPFERKTAK
FT                   FDLTLTADETDGGLTFVLEYNTALFKQETIERWKQYWMELLDAVTGNPNQPLSSLSLVT
FT                   ETEKQALLEAWKGKALPVPTDKTVHQLFEETAQRHKDRPAVTYNGQSWTYGELNAKANR
FT                   LARILMDCGISPDDRVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDS
FT                   GAKLLLKQEGISVPDSYTGDVILLDGSRTILSLPLDENDEENPETAVTAENLAYMIYTS
FT                   GTTGQPKGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTIGAE
FT                   LHVIEEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAV
FT                   KKPYTLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYILGEGNQVQPEGVAGE
FT                   LCVAGRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWTGGGIEYIGRIDQQVK
FT                   VRGYRIELSEIEVQLAQLSEVQDAAVTAVKDKGGNTAIAAYVTPESADIEALKSALKET
FT                   LPDYMIPAFWVTLNELPVTANGKVDRKALPEPDIEAGSGEYKAPTTDMEELLAGIWQDV
FT                   LGMSEVGVTDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEG
FT                   KQADQGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAKKGFDPERVEKTLQALIEH
FT                   HDALRMVYREGQEDVIQYNRGLEAASAQLEVIQIEGQAADYEDRIEREAERLQSSIDLQ
FT                   EGGLLKAGLFQAEDGDHLLLAIHHLVVDGVSWRILLEDFAAVYTQLEQGNEPVLPQKTH
FT                   SFAEYAERLQDFANSKAFLKEKEYWRQLEEQAVAAKLPKDRESGDQRMKHTKTIEFSLT
FT                   AEETEQLTTKVHEAYHTEMNDILLTAFGLAMKEWTGQDRVSVHLEGHGREEIIEDLTIS
FT                   RTVGWFTSMYPMVLDMKHADDLGYQLKQMKEDIRHVPNKGVGYGILRYLTAPEHKEDVA
FT                   FSIQPDVSFNYLGQFDEMSDAGLFTRSELPSGQSLSPETEKPNALDVVGYIENGKLTMS
FT                   LAYHSLEFHEKTVQTFSDSFKAHLLRIIEHCLSQDGTELTPSDLGDDDLTLDELDKLME
FT                   IF"
     MEITFYPLTD AQKRIWYTEK FYPHTSISNL AGIGKLVSAD AIDYVLVEQA IQEFIRRNDA        60
     MRLRLRLDEN GEPVQYISEY RPVDIKHTDT TEDPNAIEFI SQWSREETKK PLPLYDCDLF       120
     RFSLFTIKEN EVWFYANVHH VISDGISMNI LGNAIMHIYL ELASGSETKE GISHSFIDHV       180
     LSEQEYAQSK RFEKDKAFWN KQFESVPELV SLKRNASAGG SLDAERFSKD VPEALHQQIL       240
     SFCEANKVSV LSVFQSLLAA YLYRVSGQND VVTGTFMGNR TNAKEKQMLG MFVSTVPLRT       300
     NIDGGQAFSE FVKDRMKDLM KTLRHQKYPY NLLINDLRET KSSLTKLFTV SLEYQVMQWQ       360
     KEEDLAFLTE PIFSGSGLND VSIHVKDRWD TGKLTIDFDY RTDLFSREEI NMICERMITM       420
     LENALTHPEH TIDELTLISD AEKEKLLARA GGKSVSYRKD MTIPELFQEK AELLSDHPAV       480
     VFEDRTLSYR TLHEQSARIA NVLKQKGVGP DSPVAVLIER SERMITAIMG ILKAGGAYVP       540
     IDPGFPAERI QYILEDCGAD FILTESKVAA PEADAELIDL DQAIEEGAEE SLNADVNARN       600
     LAYIIYTSGT TGRPKGVMIE HRQVHHLVES LQQTIYQSGS QTLRMALLAP FHFDASVKQI       660
     FASLLLGQTL YIVPKKTVTN GAALTAYYRK NSIEATDGTP AHLQMLAAAG DFEGLKLKHM       720
     LIGGEGLSSV VADKLLKLFK EAGTAPRLTN VYGPTETCVD ASVHPVIPEN AVQSAYVPIG       780
     KALGNNRLYI LDQKGRLQPE GVAGELYIAG DGVGRGYLHL PELTEEKFLQ DPFVPGDRMY       840
     RTGDVVRWLP DGTIEYLGRE DDQVKVRGYR IELGEIEAVI QQAPDVAKAV VLARPDEQGN       900
     LEVCAYVVQK PGSEFAPAGL REHAARQLPD YMVPAYFTEV TEIPLTPSGK VDRRKLFALE       960
     VKAVSGTAYT APRNETEKAI AAIWQDVLNV EKAGIFDNFF ETGGHSLKAM TLLTKIHKET      1020
     GIEIPLQFLF EHPTITALAE EADHRESKAF AVIEPAEKQE HYPLSLAQQR TYIVSQFEDA      1080
     GVGYNMPAAA ILEGPLDIQK LERAFQGLIR RHESLRTSFV LENSTPRQKI HDSVDFNIEM      1140
     IERGGRSDEA IMASFVRTFD LAKAPLFRIG LLGLEENRHM LLFDMHHLIS DGVSIGIMLE      1200
     ELARIYKGEQ LPDLRLQYKD YAVWQSRQAA EGYKKDQAYW KEVFAGELPV LQLLSDYPRP      1260
     PVQSFEGDRV SIKLDAGVKD RLNRLAEQNG ATLYMVMLSA YYTLLSKYTG QDDIIVGTPS      1320
     AGRNHSDTEG IIGMFVNTLA IRSEVKQNET FTQLISRVRK RVLDAFSHQD YPFEWLVEDL      1380
     NIPRDVSRHP LFDTMFSLQN ATEGIPAVGD LSLSVQETNF KIAKFDLTVQ ARETDEGIEI      1440
     DVDYSTKLFK QSTADRLLTH FARLLEDAAA DPEKPISEYK LLSEEEAASQ IQQFNPGRTP      1500
     YPKDKTIVQL FEEQAANTPD HTALQYEGES LTYRELNERA NRLARGILSL GAGEGRTAAV      1560
     LCERSMDMIV SILAVLKSGS AYVPIDPEHP IQRMQHFFRD SGAKVLLTQR KLKALAEEAE      1620
     FKGVIVLADE EESYHADARN LALPLDSAAM ANLTYTSGTT GTPKGNIVTH ANILRTVKET      1680
     NYLSITEQDT ILGLSNYVFD AFMFDMFGSL LNGAKLVLIP KETVLDMARL SRVIERENIS      1740
     ILMITTALFH LLVDLNPACL STLRKIMFGG ERASVEHVRK ALQTVGKGKL LHMYGPSEST      1800
     VFATYHPVDE LEEHTLSVPI GKPVSNTEVY ILDRTGHVQP AGIAGELCVS GEGLVKGYYN      1860
     RPELTEEKFV PHPFTSGERM YKTGDLARWL PNGDIEFIGR IDHQVKIRGQ RIELGEIEHQ      1920
     LQTHDRVQES VVLAVDQGAG DKLLCAYYVG EGDISSQEMR EHAAKDLPAY MVPAVFIQMD      1980
     ELPLTGNGKI DRRALPIPDA NVSRGVSYVA PRNGTEQKVA DIWAQVLQAE QVGAYDHFFD      2040
     IGGHSLAGMK MLALVHQELG VELSLKDLFQ SPTVEGLAQV IASAEKGTAA SISPAEKQDT      2100
     YPVSSPQKRM YVLQQLEDAQ TSYNMPAVLR LTGELDVERL NSVMQQLMQR HEALRTTFEI      2160
     KDGETVQRIW EEAECEIAYF EAPEEETERI VSEFIKPFKI DQLPLFRIGL IKHSDTEHVL      2220
     LFDMHHIISD GASVGVLIEE LSKLYDGETL EPLRIQYKDY AVWQQQFIQS ELYKKQEEHW      2280
     LKELDGELPV LTLPTDYSRP AVQTFEGDRI AFSLEAGKAD ALRRLAKETD STLYMVLLAS      2340
     YSAFLSKISG QDDIIVGSPV AGRSQADVSR VIGMFVNTLA LRTYPKGEKT FADYLNEVKE      2400
     TALSAFDAQD YPLEDLIGNV QVQRDTSRNP LFDAVFSMQN ANIKDLTMKG IQLEPHPFER      2460
     KTAKFDLTLT ADETDGGLTF VLEYNTALFK QETIERWKQY WMELLDAVTG NPNQPLSSLS      2520
     LVTETEKQAL LEAWKGKALP VPTDKTVHQL FEETAQRHKD RPAVTYNGQS WTYGELNAKA      2580
     NRLARILMDC GISPDDRVGV LTKPSLEMSA AVLGVLKAGA AFVPIDPDYP DQRIEYILQD      2640
     SGAKLLLKQE GISVPDSYTG DVILLDGSRT ILSLPLDEND EENPETAVTA ENLAYMIYTS      2700
     GTTGQPKGVM VEHHALVNLC FWHHDAFSMT AEDRSAKYAG FGFDASIWEM FPTWTIGAEL      2760
     HVIEEAIRLD IVRLNDYFET NGVTITFLPT QLAEQFMELE NTSLRVLLTG GDKLKRAVKK      2820
     PYTLVNNYGP TENTVVATSA EIHPEEGSLS IGRAIANTRV YILGEGNQVQ PEGVAGELCV      2880
     AGRGLARGYL NREDETAKRF VADPFVPGER MYRTGDLVKW TGGGIEYIGR IDQQVKVRGY      2940
     RIELSEIEVQ LAQLSEVQDA AVTAVKDKGG NTAIAAYVTP ESADIEALKS ALKETLPDYM      3000
     IPAFWVTLNE LPVTANGKVD RKALPEPDIE AGSGEYKAPT TDMEELLAGI WQDVLGMSEV      3060
     GVTDNFFSLG GDSIKGIQMA SRLNQHGWKL EMKDLFQHPT IEELTQYVER AEGKQADQGP      3120
     VEGEVILTPI QRWFFEKNFT NKHHWNQSVM LHAKKGFDPE RVEKTLQALI EHHDALRMVY      3180
     REGQEDVIQY NRGLEAASAQ LEVIQIEGQA ADYEDRIERE AERLQSSIDL QEGGLLKAGL      3240
     FQAEDGDHLL LAIHHLVVDG VSWRILLEDF AAVYTQLEQG NEPVLPQKTH SFAEYAERLQ      3300
     DFANSKAFLK EKEYWRQLEE QAVAAKLPKD RESGDQRMKH TKTIEFSLTA EETEQLTTKV      3360
     HEAYHTEMND ILLTAFGLAM KEWTGQDRVS VHLEGHGREE IIEDLTISRT VGWFTSMYPM      3420
     VLDMKHADDL GYQLKQMKED IRHVPNKGVG YGILRYLTAP EHKEDVAFSI QPDVSFNYLG      3480
     QFDEMSDAGL FTRSELPSGQ SLSPETEKPN ALDVVGYIEN GKLTMSLAYH SLEFHEKTVQ      3540
     TFSDSFKAHL LRIIEHCLSQ DGTELTPSDL GDDDLTLDEL DKLMEIF                    3587
//

If you have problems or comments...

PBIL Back to PBIL home page