(data stored in SCRATCH zone)

EMBL: AL009126.SRFAB

AL009126.SRFAB       Location/Qualifiers
FT   CDS             387744..398495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAB"
FT                   /locus_tag="BSU_03490"
FT                   /old_locus_tag="BSU03490"
FT                   /product="surfactin synthetase"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15066026, 16166527, 16553878,
FT                   17227471, 14762003, 26284661; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12143"
FT                   /db_xref="GOA:Q04747"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="SubtiList:BG10169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04747"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15066026, 16166527, 16553878, 17227471, 14762003,
FT                   26284661"
FT                   /protein_id="CAB12143.2"
FT                   /translation="MSKKSIQKVYALTPMQEGMLYHAMLDPHSSSYFTQLELGIHGAFD
FT                   LEIFEKSVNELIRSYDILRTVFVHQQLQKPRQVVLAERKTKVHYEDISHADENRQKEHI
FT                   ERYKQDVQRQGFNLAKDILFKVAVFRLAADQLYLVWSNHHIMMDGWSMGVLMKSLFQNY
FT                   EALRAGRTPANGQGKPYSDYIKWLGKQDNEEAESYWSERLAGFEQPSVLPGRLPVKKDE
FT                   YVNKEYSFTWDETLVARIQQTANLHQVTGPNLFQAVWGIVLSKYNFTDDVIFGTVVSGR
FT                   PSEINGIETMAGLFINTIPVRVKVERDAAFADIFTAVQQHAVEAERYDYVPLYEIQKRS
FT                   ALDGNLLNHLVAFENYPLDQELENGSMEDRLGFSIKVESAFEQTSFDFNLIVYPGKTWT
FT                   VKIKYNGAAFDSAFIERTAEHLTRMMEAAVDQPAAFVREYGLVGDEEQRQIVEVFNSTK
FT                   AELPEGMAVHQVFEEQAKRTPASTAVVYEGTKLTYRELNAAANRLARKLVEHGLQKGET
FT                   AAIMNDRSVETVVGMLAVLKAGAAYVPLDPALPGDRLRFMAEDSSVRMVLIGNSYTGQA
FT                   HQLQVPVLTLDIGFEESEAADNLNLPSAPSDLAYIMYTSGSTGKPKGVMIEHKSILRLV
FT                   KNAGYVPVTEEDRMAQTGAVSFDAGTFEVFGALLNGAALYPVKKETLLDAKQFAAFLRE
FT                   QSITTMWLTSPLFNQLAAKDAGMFGTLRHLIIGGDALVPHIVSKVKQASPSLSLWNGYG
FT                   PTENTTFSTSFLIDREYGGSIPIGKPIGNSTAYIMDEQQCLQPIGAPGELCVGGIGVAR
FT                   GYVNLPELTEKQFLEDPFRPGERIYRTGDLARWLPDGNIEFLGRIDNQVKVRGFRIELG
FT                   EIETKLNMAEHVTEAAVIIRKNKADENEICAYFTADREVAVSELRKTLSQSLPDYMVPA
FT                   HLIQMDSLPLTPNGKINKKELPAPQSEAVQPEYAAPKTESEKKLAEIWEGILGVKAGVT
FT                   DNFFMIGGHSLKAMMMTAKIQEHFHKEVPIKVLFEKPTIQELALYLEENESKEEQTFEP
FT                   IRQASYQQHYPVSPAQRRMYILNQLGQANTSYNVPAVLLLEGEVDKDRLENAIQQLINR
FT                   HEILRTSFDMIDGEVVQTVHKNISFQLEAAKGREEDAEEIIKAFVQPFELNRAPLVRSK
FT                   LVQLEEKRHLLLIDMHHIITDGSSTGILIGDLAKIYQGADLELPQIHYKDYAVWHKEQT
FT                   NYQKDEEYWLDVFKGELPILDLPADFERPAERSFAGERVMFGLDKQITAQIKSLMAETD
FT                   TTMYMFLLAAFNVLLSKYASQDDIIVGSPTAGRTHPDLQGVPGMFVNTVALRTAPAGDK
FT                   TFAQFLEEVKTASLQAFEHQSYPLEELIEKLPLTRDTSRSPLFSVMFNMQNMEIPSLRL
FT                   GDLKISSYSMLHHVAKFDLSLEAVEREEDIGLSFDYATALFKDETIRRWSRHFVNIIKA
FT                   AAANPNVRLSDVDLLSSAETAALLEERHMTQITEATFAALFEKQAQQTPDHSAVKAGGN
FT                   LLTYRELDEQANQLAHHLRAQGAGNEDIVAIVMDRSAEVMVSILGVMKAGAAFLPIDPD
FT                   TPEERIRYSLEDSGAKFAVVNERNMTAIGQYEGIIVSLDDGKWRNESKERPSSISGSRN
FT                   LAYVIYTSGTTGKPKGVQIEHRNLTNYVSWFSEEAGLTENDKTVLLSSYAFDLGYTSMF
FT                   PVLLGGGELHIVQKETYTAPDEIAHYIKEHGITYIKLTPSLFHTIVNTASFAKDANFES
FT                   LRLIVLGGEKIIPTDVIAFRKMYGHTEFINHYGPTEATIGAIAGRVDLYEPDAFAKRPT
FT                   IGRPIANAGALVLNEALKLVPPGASGQLYITGQGLARGYLNRPQLTAERFVENPYSPGS
FT                   LMYKTGDVVRRLSDGTLAFIGRADDQVKIRGYRIEPKEIETVMLSLSGIQEAVVLAVSE
FT                   GGLQELCAYYTSDQDIEKAELRYQLSLTLPSHMIPAFFVQVDAIPLTANGKTDRNALPK
FT                   PNAAQSGGKALAAPETALEESLCRIWQKTLGIEAIGIDDNFFDLGGHSLKGMMLIANIQ
FT                   AELEKSVPLKALFEQPTVRQLAAYMEASAVSGGHQVLKPADKQDMYPLSSAQKRMYVLN
FT                   QLDRQTISYNMPSVLLMEGELDISRLRDSLNQLVNRHESLRTSFMEANGEPVQRIIEKA
FT                   EVDLHVFEAKEDEADQKIKEFIRPFDLNDAPLIRAALLRIEAKKHLLLLDMHHIIADGV
FT                   SRGIFVKELALLYKGEQLPEPTLHYKDFAVWQNEAEQKERMKEHEAYWMSVLSGELPEL
FT                   DLPLDYARPPVQSFKGDTIRFRTGSETAKAVEKLLAETGTTLHMVLHAVFHVFLSKISG
FT                   QRDIVIGSVTAGRTNADVQDMPGMFVNTLALRMEAKEQQTFAELLELAKQTNLSALEHQ
FT                   EYPFEDLVNQLDLPRDMSRNPLFNVMVTTENPDKEQLTLQNLSISPYEAHQGTSKFDLT
FT                   LGGFTDENGIGLQLEYATDLFAKETAEKWSEYVLRLLKAVADNPNQPLSSLLLVTETEK
FT                   QALLEAWKGKALPVPTDKTVHQLFEETVQRHKDRPAVTYNGQSWTYGELNAKANRLARI
FT                   LMDCGISPDDRVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDSGAKL
FT                   LLKQEGISVPDSYTGDVILLDGSRTILSLPLDENDEGNPETAVTAENLAYMIYTSGTTG
FT                   QPKGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTIGAELHVI
FT                   DEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAVKKPY
FT                   TLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYILGEGNQVQPEGVAGELCVA
FT                   GRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWVNGGIEYIGRIDQQVKVRGY
FT                   RIELSEIEVQLAQLSEVQDAAVTAVKDKGGNTAIAAYVTPETADIEALKSTLKETLPDY
FT                   MIPAFWVTLNELPVTANGKVDRKALPEPDIEAGSGEYKAPTTDMEELLAGIWQDVLGMS
FT                   EVGVTDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEGKQAD
FT                   QGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAKKGFDPERVEKTLQALIEHHDAL
FT                   RMVYREENGDIVQVYKPIGESKVSFEIVDLYGSDEEMLRSQIKLLANKLQSSLDLRNGP
FT                   LLKAEQYRTEAGDHLLIAVHHLVVDGVSWRILLEDFASGYMQAEKEESLVFPQKTNSFK
FT                   DWAEELAAFSQSAHLLQQAEYWSQIAAEQVSPLPKDCETEQRIVKDTSSVLCELTAEDT
FT                   KHLLTDVHQPYGTEINDILLSALGLTMKEWTKGAKIGINLEGHGREDIIPNVNISRTVG
FT                   WFTAQYPVVLDISDADASAVIKTVKENLRRIPDKGVGYGILRYFTETAETKGFTPEISF
FT                   NYLGQFDSEVKTDFFEPSAFDMGRQVSGESEALYALSFSGMIRNGRFVLSCSYNEKEFE
FT                   RATVEEQMERFKENLLMLIRHCTEKEDKEFTPSDFSAEDLEMDEMGDIFDMLEENLK"
     MSKKSIQKVY ALTPMQEGML YHAMLDPHSS SYFTQLELGI HGAFDLEIFE KSVNELIRSY        60
     DILRTVFVHQ QLQKPRQVVL AERKTKVHYE DISHADENRQ KEHIERYKQD VQRQGFNLAK       120
     DILFKVAVFR LAADQLYLVW SNHHIMMDGW SMGVLMKSLF QNYEALRAGR TPANGQGKPY       180
     SDYIKWLGKQ DNEEAESYWS ERLAGFEQPS VLPGRLPVKK DEYVNKEYSF TWDETLVARI       240
     QQTANLHQVT GPNLFQAVWG IVLSKYNFTD DVIFGTVVSG RPSEINGIET MAGLFINTIP       300
     VRVKVERDAA FADIFTAVQQ HAVEAERYDY VPLYEIQKRS ALDGNLLNHL VAFENYPLDQ       360
     ELENGSMEDR LGFSIKVESA FEQTSFDFNL IVYPGKTWTV KIKYNGAAFD SAFIERTAEH       420
     LTRMMEAAVD QPAAFVREYG LVGDEEQRQI VEVFNSTKAE LPEGMAVHQV FEEQAKRTPA       480
     STAVVYEGTK LTYRELNAAA NRLARKLVEH GLQKGETAAI MNDRSVETVV GMLAVLKAGA       540
     AYVPLDPALP GDRLRFMAED SSVRMVLIGN SYTGQAHQLQ VPVLTLDIGF EESEAADNLN       600
     LPSAPSDLAY IMYTSGSTGK PKGVMIEHKS ILRLVKNAGY VPVTEEDRMA QTGAVSFDAG       660
     TFEVFGALLN GAALYPVKKE TLLDAKQFAA FLREQSITTM WLTSPLFNQL AAKDAGMFGT       720
     LRHLIIGGDA LVPHIVSKVK QASPSLSLWN GYGPTENTTF STSFLIDREY GGSIPIGKPI       780
     GNSTAYIMDE QQCLQPIGAP GELCVGGIGV ARGYVNLPEL TEKQFLEDPF RPGERIYRTG       840
     DLARWLPDGN IEFLGRIDNQ VKVRGFRIEL GEIETKLNMA EHVTEAAVII RKNKADENEI       900
     CAYFTADREV AVSELRKTLS QSLPDYMVPA HLIQMDSLPL TPNGKINKKE LPAPQSEAVQ       960
     PEYAAPKTES EKKLAEIWEG ILGVKAGVTD NFFMIGGHSL KAMMMTAKIQ EHFHKEVPIK      1020
     VLFEKPTIQE LALYLEENES KEEQTFEPIR QASYQQHYPV SPAQRRMYIL NQLGQANTSY      1080
     NVPAVLLLEG EVDKDRLENA IQQLINRHEI LRTSFDMIDG EVVQTVHKNI SFQLEAAKGR      1140
     EEDAEEIIKA FVQPFELNRA PLVRSKLVQL EEKRHLLLID MHHIITDGSS TGILIGDLAK      1200
     IYQGADLELP QIHYKDYAVW HKEQTNYQKD EEYWLDVFKG ELPILDLPAD FERPAERSFA      1260
     GERVMFGLDK QITAQIKSLM AETDTTMYMF LLAAFNVLLS KYASQDDIIV GSPTAGRTHP      1320
     DLQGVPGMFV NTVALRTAPA GDKTFAQFLE EVKTASLQAF EHQSYPLEEL IEKLPLTRDT      1380
     SRSPLFSVMF NMQNMEIPSL RLGDLKISSY SMLHHVAKFD LSLEAVEREE DIGLSFDYAT      1440
     ALFKDETIRR WSRHFVNIIK AAAANPNVRL SDVDLLSSAE TAALLEERHM TQITEATFAA      1500
     LFEKQAQQTP DHSAVKAGGN LLTYRELDEQ ANQLAHHLRA QGAGNEDIVA IVMDRSAEVM      1560
     VSILGVMKAG AAFLPIDPDT PEERIRYSLE DSGAKFAVVN ERNMTAIGQY EGIIVSLDDG      1620
     KWRNESKERP SSISGSRNLA YVIYTSGTTG KPKGVQIEHR NLTNYVSWFS EEAGLTENDK      1680
     TVLLSSYAFD LGYTSMFPVL LGGGELHIVQ KETYTAPDEI AHYIKEHGIT YIKLTPSLFH      1740
     TIVNTASFAK DANFESLRLI VLGGEKIIPT DVIAFRKMYG HTEFINHYGP TEATIGAIAG      1800
     RVDLYEPDAF AKRPTIGRPI ANAGALVLNE ALKLVPPGAS GQLYITGQGL ARGYLNRPQL      1860
     TAERFVENPY SPGSLMYKTG DVVRRLSDGT LAFIGRADDQ VKIRGYRIEP KEIETVMLSL      1920
     SGIQEAVVLA VSEGGLQELC AYYTSDQDIE KAELRYQLSL TLPSHMIPAF FVQVDAIPLT      1980
     ANGKTDRNAL PKPNAAQSGG KALAAPETAL EESLCRIWQK TLGIEAIGID DNFFDLGGHS      2040
     LKGMMLIANI QAELEKSVPL KALFEQPTVR QLAAYMEASA VSGGHQVLKP ADKQDMYPLS      2100
     SAQKRMYVLN QLDRQTISYN MPSVLLMEGE LDISRLRDSL NQLVNRHESL RTSFMEANGE      2160
     PVQRIIEKAE VDLHVFEAKE DEADQKIKEF IRPFDLNDAP LIRAALLRIE AKKHLLLLDM      2220
     HHIIADGVSR GIFVKELALL YKGEQLPEPT LHYKDFAVWQ NEAEQKERMK EHEAYWMSVL      2280
     SGELPELDLP LDYARPPVQS FKGDTIRFRT GSETAKAVEK LLAETGTTLH MVLHAVFHVF      2340
     LSKISGQRDI VIGSVTAGRT NADVQDMPGM FVNTLALRME AKEQQTFAEL LELAKQTNLS      2400
     ALEHQEYPFE DLVNQLDLPR DMSRNPLFNV MVTTENPDKE QLTLQNLSIS PYEAHQGTSK      2460
     FDLTLGGFTD ENGIGLQLEY ATDLFAKETA EKWSEYVLRL LKAVADNPNQ PLSSLLLVTE      2520
     TEKQALLEAW KGKALPVPTD KTVHQLFEET VQRHKDRPAV TYNGQSWTYG ELNAKANRLA      2580
     RILMDCGISP DDRVGVLTKP SLEMSAAVLG VLKAGAAFVP IDPDYPDQRI EYILQDSGAK      2640
     LLLKQEGISV PDSYTGDVIL LDGSRTILSL PLDENDEGNP ETAVTAENLA YMIYTSGTTG      2700
     QPKGVMVEHH ALVNLCFWHH DAFSMTAEDR SAKYAGFGFD ASIWEMFPTW TIGAELHVID      2760
     EAIRLDIVRL NDYFETNGVT ITFLPTQLAE QFMELENTSL RVLLTGGDKL KRAVKKPYTL      2820
     VNNYGPTENT VVATSAEIHP EEGSLSIGRA IANTRVYILG EGNQVQPEGV AGELCVAGRG      2880
     LARGYLNRED ETAKRFVADP FVPGERMYRT GDLVKWVNGG IEYIGRIDQQ VKVRGYRIEL      2940
     SEIEVQLAQL SEVQDAAVTA VKDKGGNTAI AAYVTPETAD IEALKSTLKE TLPDYMIPAF      3000
     WVTLNELPVT ANGKVDRKAL PEPDIEAGSG EYKAPTTDME ELLAGIWQDV LGMSEVGVTD      3060
     NFFSLGGDSI KGIQMASRLN QHGWKLEMKD LFQHPTIEEL TQYVERAEGK QADQGPVEGE      3120
     VILTPIQRWF FEKNFTNKHH WNQSVMLHAK KGFDPERVEK TLQALIEHHD ALRMVYREEN      3180
     GDIVQVYKPI GESKVSFEIV DLYGSDEEML RSQIKLLANK LQSSLDLRNG PLLKAEQYRT      3240
     EAGDHLLIAV HHLVVDGVSW RILLEDFASG YMQAEKEESL VFPQKTNSFK DWAEELAAFS      3300
     QSAHLLQQAE YWSQIAAEQV SPLPKDCETE QRIVKDTSSV LCELTAEDTK HLLTDVHQPY      3360
     GTEINDILLS ALGLTMKEWT KGAKIGINLE GHGREDIIPN VNISRTVGWF TAQYPVVLDI      3420
     SDADASAVIK TVKENLRRIP DKGVGYGILR YFTETAETKG FTPEISFNYL GQFDSEVKTD      3480
     FFEPSAFDMG RQVSGESEAL YALSFSGMIR NGRFVLSCSY NEKEFERATV EEQMERFKEN      3540
     LLMLIRHCTE KEDKEFTPSD FSAEDLEMDE MGDIFDMLEE NLK                        3583
//

If you have problems or comments...

PBIL Back to PBIL home page