(data stored in SCRATCH zone)

EMBL: AL009126.SRFAD

AL009126.SRFAD       Location/Qualifiers
FT   CDS             402388..403116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAD"
FT                   /locus_tag="BSU_03520"
FT                   /old_locus_tag="BSU03520"
FT                   /product="surfactin synthetase"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16166527, 16553878, 17227471,
FT                   14762003, 22720735, 26284661; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12146"
FT                   /db_xref="GOA:Q08788"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:2K2Q"
FT                   /db_xref="PDB:2RON"
FT                   /db_xref="SubtiList:BG10171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08788"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16166527, 16553878, 17227471, 14762003, 22720735,
FT                   26284661"
FT                   /protein_id="CAB12146.1"
FT                   /translation="MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAA
FT                   EPPGHGTNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGI
FT                   FPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSD
FT                   YRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQ
FT                   TEEVAERIFAILNQHPIIQP"
     MSQLFKSFDA SEKTQLICFP FAGGYSASFR PLHAFLQGEC EMLAAEPPGH GTNQTSAIED        60
     LEELTDLYKQ ELNLRPDRPF VLFGHSMGGM ITFRLAQKLE REGIFPQAVI ISAIQPPHIQ       120
     RKKVSHLPDD QFLDHIIQLG GMPAELVENK EVMSFFLPSF RSDYRALEQF ELYDLAQIQS       180
     PVHVFNGLDD KKCIRDAEGW KKWAKDITFH QFDGGHMFLL SQTEEVAERI FAILNQHPII       240
     QP                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page