(data stored in SCRATCH zone)

EMBL: AL009126.TADA

AL009126.TADA        Location/Qualifiers
FT   CDS             25852..26337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="BSU_00180"
FT                   /old_locus_tag="BSU00180"
FT                   /product="tRNA specific adenosine A34 deaminase"
FT                   /function="10.3: tRNA and rRNA base modification"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.4.33"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15677468, 16014871, 16415880,
FT                   16700551, 23658230; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11794"
FT                   /db_xref="GOA:P21335"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="SubtiList:BG10082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21335"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11794.1"
FT                   /translation="MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVINGEIIARAHNLRE
FT                   TEQRSIAHAEMLVIDEACKALGTWRLEGATLYVTLEPCPMCAGAVVLSRVEKVVFGAFD
FT                   PKGGCSGTLMNLLQEERFNHQAEVVSGVLEEECGGMLSAFFRELRKKKKAARKNLSE"
     MTQDELYMKE AIKEAKKAEE KGEVPIGAVL VINGEIIARA HNLRETEQRS IAHAEMLVID        60
     EACKALGTWR LEGATLYVTL EPCPMCAGAV VLSRVEKVVF GAFDPKGGCS GTLMNLLQEE       120
     RFNHQAEVVS GVLEEECGGM LSAFFRELRK KKKAARKNLS E                           161
//

If you have problems or comments...

PBIL Back to PBIL home page