(data stored in ACNUC7421 zone)

EMBL: AL009126.TATCD

AL009126.TATCD       Location/Qualifiers
FT   CDS             286048..286776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCD"
FT                   /locus_tag="BSU_02640"
FT                   /old_locus_tag="BSU02640"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16698798, 19049517, 27984091;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12058"
FT                   /db_xref="GOA:P42252"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="SubtiList:BG11175"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42252"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16698798, 19049517, 27984091"
FT                   /protein_id="CAB12058.2"
FT                   /translation="MDKKETHLIGHLEELRRRIIVTLAAFFLFLITAFLFVQDIYDWLI
FT                   RDLDGKLAVLGPSEILWVYMMLSGICAIAASIPVAAYQLWRFVAPALTKTERKVTLMYI
FT                   PGLFALFLAGISFGYFVLFPIVLSFLTHLSSGHFETMFTADRYFRFMVNLSLPFGFLFE
FT                   MPLVVMFLTRLGILNPYRLAKARKLSYFLLIVVSILITPPDFISDFLVMIPLLVLFEVS
FT                   VTLSAFVYKKRMREETAAAA"
     MDKKETHLIG HLEELRRRII VTLAAFFLFL ITAFLFVQDI YDWLIRDLDG KLAVLGPSEI        60
     LWVYMMLSGI CAIAASIPVA AYQLWRFVAP ALTKTERKVT LMYIPGLFAL FLAGISFGYF       120
     VLFPIVLSFL THLSSGHFET MFTADRYFRF MVNLSLPFGF LFEMPLVVMF LTRLGILNPY       180
     RLAKARKLSY FLLIVVSILI TPPDFISDFL VMIPLLVLFE VSVTLSAFVY KKRMREETAA       240
     AA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page