(data stored in SCRATCH zone)

EMBL: AL009126.TCYA

AL009126.TCYA        Location/Qualifiers
FT   CDS             complement(410656..411462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyA"
FT                   /locus_tag="BSU_03610"
FT                   /old_locus_tag="BSU03610"
FT                   /product="cystine ABC transporter (substrate-binding
FT                   lipoprotein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15262924, 22212096; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12155"
FT                   /db_xref="GOA:P42199"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="SubtiList:BG11187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42199"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15262924, 22212096"
FT                   /protein_id="CAB12155.2"
FT                   /translation="MKKALLALFMVVSIAALAACGAGNDNQSKDNAKDGDLWASIKKKG
FT                   VLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSK
FT                   RFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNY
FT                   NKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGE
FT                   PQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK"
     MKKALLALFM VVSIAALAAC GAGNDNQSKD NAKDGDLWAS IKKKGVLTVG TEGTYEPFTY        60
     HDKDTDKLTG YDVEVITEVA KRLGLKVDFK ETQWDSMFAG LNSKRFDVVA NQVGKTDRED       120
     KYDFSDKYTT SRAVVVTKKD NNDIKSEADV KGKTSAQSLT SNYNKLATNA GAKVEGVEGM       180
     AQALQMIQQG RVDMTYNDKL AVLNYLKTSG NKNVKIAFET GEPQSTYFTF RKGSGEVVDQ       240
     VNKALKEMKE DGTLSKISKK WFGEDVSK                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page