(data stored in ACNUC7421 zone)

EMBL: AL009126.TCYC

AL009126.TCYC        Location/Qualifiers
FT   CDS             complement(409208..409951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyC"
FT                   /locus_tag="BSU_03590"
FT                   /old_locus_tag="BSU03590"
FT                   /product="cystine ABC transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15262924, 16513748, 22212096;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12153"
FT                   /db_xref="GOA:P39456"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="SubtiList:BG11185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39456"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15262924, 16513748, 22212096"
FT                   /protein_id="CAB12153.2"
FT                   /translation="MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLR
FT                   CLNALEIPNRGELAFDDFSIDFSKKVKQADILKLRRKSGMVFQAYHLFPHRTALENVME
FT                   GPVQVQKRNKEEVRKEAIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELML
FT                   FDEPTSALDPELVGEVLKVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQG
FT                   PPEQIFSAPKEERTQRFLNRILNPL"
     MLTVKGLNKS FGENEILKKI DMKIEKGKVI AILGPSGSGK TTLLRCLNAL EIPNRGELAF        60
     DDFSIDFSKK VKQADILKLR RKSGMVFQAY HLFPHRTALE NVMEGPVQVQ KRNKEEVRKE       120
     AIQLLDKVGL KDKMDLYPFQ LSGGQQQRVG IARALAIQPE LMLFDEPTSA LDPELVGEVL       180
     KVIKDLANEG WTMVVVTHEI KFAQEVADEV IFIDGGVIVE QGPPEQIFSA PKEERTQRFL       240
     NRILNPL                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page