(data stored in ACNUC7421 zone)

EMBL: AL009126.THRD

AL009126.THRD        Location/Qualifiers
FT   CDS             complement(430623..431987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrD"
FT                   /locus_tag="BSU_03790"
FT                   /old_locus_tag="BSU03790"
FT                   /product="aspartate kinase III"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.2.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2152900, 11471740, 27260660;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12187"
FT                   /db_xref="GOA:P94417"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="SubtiList:BG12033"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94417"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2152900, 11471740, 27260660"
FT                   /protein_id="CAB12187.1"
FT                   /translation="MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAED
FT                   TKVTDLLIACAEQYLATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGD
FT                   KSNPEQYLDAVKASGEDNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPES
FT                   YQNLYRLRERDGLIIFPGFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVD
FT                   AVYSVNPSFVENPKEISELTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPS
FT                   AEGTRVVSKRDNTNGPVVGIASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEH
FT                   VPSGIDDMTIILRQGQMDAATERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVG
FT                   TTARAAKALSEAQVNIEMINQGSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS"
     MKVVKFGGSS LASGAQLDKV FHIVTSDPAR KAVVVSAPGK HYAEDTKVTD LLIACAEQYL        60
     ATGSAPELAE AVVERYALIA NELQLGQSII EKIRDDLFTL LEGDKSNPEQ YLDAVKASGE       120
     DNNAKLIAAY FRYKGVKAEY VNPKDAGLFV TNEPGNAQVL PESYQNLYRL RERDGLIIFP       180
     GFFGFSKDGD VITFSRSGSD ITGSILANGL QADLYENFTD VDAVYSVNPS FVENPKEISE       240
     LTYREMRELS YAGFSVFHDE ALIPAFRAGI PVQIKNTNNP SAEGTRVVSK RDNTNGPVVG       300
     IASDTGFCSI YISKYLMNRE IGFGRRALQI LEEHGLTYEH VPSGIDDMTI ILRQGQMDAA       360
     TERSVIKRIE EDLHADEVIV EHHLALIMVV GEAMRHNVGT TARAAKALSE AQVNIEMINQ       420
     GSSEVSMMFG VKEAEERKAV QALYQEFFAG VLIS                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page