(data stored in SCRATCH zone)

EMBL: AL009126.TILS

AL009126.TILS        Location/Qualifiers
FT   CDS             74929..76347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BSU_00670"
FT                   /old_locus_tag="BSU00670"
FT                   /product="tRNA(ile2) lysidine synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.3.4.19"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14527414, 16039592,
FT                   17005971, 22720735, 24001521; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11843"
FT                   /db_xref="GOA:P37563"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="SubtiList:BG10130"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37563"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14527414, 16039592, 17005971, 22720735,
FT                   24001521"
FT                   /protein_id="CAB11843.1"
FT                   /translation="MKSVKDFLNKHNLTLKGATIIVGVSGGPDSMALLHALHTLCGRSA
FT                   NVIAAHVDHRFRGAESEEDMRFVQAYCKAEQLVCETAQINVTAYAQEKGLNKQAAARDC
FT                   RYQFFEEIMSKHQADYLALAHHGDDQVETMLMKLAKGTLGTGLAGMQPVRRFGTGRIIR
FT                   PFLTITKEEILHYCHENGLSYRTDESNAKDDYTRNRFRKTVLPFLKQESPDVHKRFQKV
FT                   SEALTEDEQFLQSLTKDEMNKVITSQSNTSVEINSSQLLALPMPLQRRGVQLILNYLYE
FT                   NVPSSFSAHHIQQFLDWAENGGPSGVLDFPKGLKVVKSYQTCLFTFEQWQCKNVPFEYQ
FT                   ISGAADETAVLPNGYLIEARHYADSPEEHGNAVFITSEKKVRFPLTIRTRKAGDRIKLK
FT                   GMNGSKKVKDIFIDKKLPLQERDNWPIVTDASGEIIWIPGLKKSIFEDLVIPNSDRIVL
FT                   QYRQHEKCRGQAKS"
     MKSVKDFLNK HNLTLKGATI IVGVSGGPDS MALLHALHTL CGRSANVIAA HVDHRFRGAE        60
     SEEDMRFVQA YCKAEQLVCE TAQINVTAYA QEKGLNKQAA ARDCRYQFFE EIMSKHQADY       120
     LALAHHGDDQ VETMLMKLAK GTLGTGLAGM QPVRRFGTGR IIRPFLTITK EEILHYCHEN       180
     GLSYRTDESN AKDDYTRNRF RKTVLPFLKQ ESPDVHKRFQ KVSEALTEDE QFLQSLTKDE       240
     MNKVITSQSN TSVEINSSQL LALPMPLQRR GVQLILNYLY ENVPSSFSAH HIQQFLDWAE       300
     NGGPSGVLDF PKGLKVVKSY QTCLFTFEQW QCKNVPFEYQ ISGAADETAV LPNGYLIEAR       360
     HYADSPEEHG NAVFITSEKK VRFPLTIRTR KAGDRIKLKG MNGSKKVKDI FIDKKLPLQE       420
     RDNWPIVTDA SGEIIWIPGL KKSIFEDLVI PNSDRIVLQY RQHEKCRGQA KS               472
//

If you have problems or comments...

PBIL Back to PBIL home page